[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67261.1
DDBJ      :             glutathione transport system permease protein GsiD
Swiss-Prot:GSID_SALTY   RecName: Full=Glutathione transport system permease protein gsiD;

Homologs  Archaea  56/68 : Bacteria  792/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   100->232 3dhwA PDBj 4e-04 29.1 %
:RPS:SCOP  60->297 2r6gG1  f.58.1.1 * 4e-25 14.0 %
:HMM:PFM   119->302 PF00528 * BPD_transp_1 1.8e-33 29.5 173/185  
:HMM:PFM   25->57 PF04854 * DUF624 0.00012 18.2 33/77  
:BLT:SWISS 1->303 GSID_SALTY e-173 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67261.1 GT:GENE ACF67261.1 GT:PRODUCT glutathione transport system permease protein GsiD GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 969782..970693 GB:FROM 969782 GB:TO 970693 GB:DIRECTION + GB:PRODUCT glutathione transport system permease protein GsiD GB:NOTE identified by match to protein family HMM PF00528 GB:PROTEIN_ID ACF67261.1 GB:DB_XREF GI:194407042 LENGTH 303 SQ:AASEQ MRLFNWRRQAILHAMPVVKPDQIRTPWREFWRRFRRQHVALVAGGFVLALILVAIFARWLTPYDAENYFDYDSLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASLSFLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPKIKG GT:EXON 1|1-303:0| SW:ID GSID_SALTY SW:DE RecName: Full=Glutathione transport system permease protein gsiD; SW:GN Name=gsiD; OrderedLocusNames=STM0851; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->303|GSID_SALTY|e-173|100.0|303/303| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 7 TM:REGION 38->60| TM:REGION 101->123| TM:REGION 137->159| TM:REGION 171->193| TM:REGION 202->224| TM:REGION 226->246| TM:REGION 267->289| BL:PDB:NREP 1 BL:PDB:REP 100->232|3dhwA|4e-04|29.1|127/203| HM:PFM:NREP 2 HM:PFM:REP 119->302|PF00528|1.8e-33|29.5|173/185|BPD_transp_1| HM:PFM:REP 25->57|PF04854|0.00012|18.2|33/77|DUF624| RP:SCP:NREP 1 RP:SCP:REP 60->297|2r6gG1|4e-25|14.0|236/284|f.58.1.1| OP:NHOMO 3662 OP:NHOMOORG 855 OP:PATTERN 4441313255553443343332113336435212---1-----113-52-DA5-54433133314-11 1114D453344-5123322-23112A222222433338791A497EB536638A732611552395887A43333733323-411111--------2--------11--122222222222222211111111121466952216A3322333222211111132215322111111111111A5433771423777775685657656A76663766324C522222222E6155555555655556333322222331-12111--33111112234333333311112211111112222222222222231123211111C46244434541423222111153153C-111BA631-282-3263174311----1121132HJP114854B1AAAAA998AAL-44C43A3DRP1-nRRXJJEXTMOPK4-116BEB7BB8DF1111111123322319-------------------------------11-1CFCBC68878644555559955552566E64A7113342353353D5DT241132242-------111221346132352233331111111211----14111111------112212221113-1211553121111161111111111111111121--13321------77LE3977777777777-7777777777777777776BCBCA3366666666666656566977667574-666666666666--111-1-111111174844412323322523322222121234233233658265442ABA1----1---256666666656688--1-------------12111122111111117-111211-1111-2111112112111143754AEA87212 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------1--1---1-------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 41.9 SQ:SECSTR ###################################################################################################HHHHHHHHHHHHHHHHHHTTGGGGGGccHH#####HHHHHHHHHHHHccHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHH#HHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHH####################################################################### DISOP:02AL 12-23,302-304| PSIPRED cccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccHHHccHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //