[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67266.1
DDBJ      :             type I secretion outer membrane protein, TolC family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  126/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.5.1
:469 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   73->469 1tqqA PDBj 5e-11 23.1 %
:RPS:PDB   64->457 1ek9A PDBj 1e-31 18.7 %
:RPS:SCOP  60->449 1wp1A  f.5.1.1 * 7e-33 16.2 %
:HMM:SCOP  60->471 1ek9A_ f.5.1.1 * 2.3e-63 29.2 %
:RPS:PFM   64->243 PF02321 * OEP 7e-12 33.1 %
:RPS:PFM   325->439 PF02321 * OEP 3e-05 29.6 %
:HMM:PFM   62->243 PF02321 * OEP 1.9e-32 28.0 182/188  
:HMM:PFM   273->446 PF02321 * OEP 8.8e-25 31.2 173/188  
:BLT:SWISS 73->453 TOLC_SALEN 3e-11 22.9 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67266.1 GT:GENE ACF67266.1 GT:PRODUCT type I secretion outer membrane protein, TolC family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2847318..2848727 GB:FROM 2847318 GB:TO 2848727 GB:DIRECTION + GB:PRODUCT type I secretion outer membrane protein, TolC family GB:NOTE identified by match to protein family HMM PF02321; match to protein family HMM TIGR01844 GB:PROTEIN_ID ACF67266.1 GB:DB_XREF GI:194407047 LENGTH 469 SQ:AASEQ MGRVAPVAIVLAFALFHHQPRGAEAPPMITSEGLATDQMLPSLDGSAAELPLSAAAPGNLTLNDAVNRAVNWHPSIREAIGKLLAQNEQIEVAKSKYYPQVSAGVNNGYSNTYTDHGYSPSLVLSVSQMLYDFGKVASQVRAETAGAAQQQANVLLSIDTVAHETANAIVQTQSWQQMVEAAEEQLVALDSIGKLIRQRSDEGATSLSDVVQTEARIESARSQLAQYQANLDSAKASLMSWLGWNSLNGINNDFPAKLARSCETATPDDRLVPAVLAAWAQANVARANLDYASAQMTPTISLEPSVQHYLNDKYPSHEVLDKTQYSTWVKVEMPLYQGGGLTARRNAASHAVDAAQSTIQRTRLDVRQKLMEARSQAMSLASALQILRRQQQLSERTRELYQQQYLDLGSRPLLDVLNAEQEVYQARFAELQTESQLHQLQLNCLYNTGALRQAFALNHRSIQSVEIQP GT:EXON 1|1-469:0| BL:SWS:NREP 1 BL:SWS:REP 73->453|TOLC_SALEN|3e-11|22.9|371/491| COIL:NAA 55 COIL:NSEG 3 COIL:REGION 207->241| COIL:REGION 365->368| COIL:REGION 373->388| SEG 45->58|gsaaelplsaaapg| SEG 271->289|lvpavlaawaqanvaranl| BL:PDB:NREP 1 BL:PDB:REP 73->469|1tqqA|5e-11|23.1|381/428| RP:PDB:NREP 1 RP:PDB:REP 64->457|1ek9A|1e-31|18.7|391/423| RP:PFM:NREP 2 RP:PFM:REP 64->243|PF02321|7e-12|33.1|178/189|OEP| RP:PFM:REP 325->439|PF02321|3e-05|29.6|114/189|OEP| HM:PFM:NREP 2 HM:PFM:REP 62->243|PF02321|1.9e-32|28.0|182/188|OEP| HM:PFM:REP 273->446|PF02321|8.8e-25|31.2|173/188|OEP| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF02321|IPR003423| GO:PFM GO:0006810|"GO:transport"|PF02321|IPR003423| GO:PFM GO:0005215|"GO:transporter activity"|PF02321|IPR003423| GO:PFM GO:0006810|"GO:transport"|PF02321|IPR003423| RP:SCP:NREP 1 RP:SCP:REP 60->449|1wp1A|7e-33|16.2|388/456|f.5.1.1| HM:SCP:REP 60->471|1ek9A_|2.3e-63|29.2|407/428|f.5.1.1|1/1|Outer membrane efflux proteins (OEP)| OP:NHOMO 141 OP:NHOMOORG 126 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------1--------------------11----22----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------112-111-11-11111111111----------------1--1---11-----1-1----1---------------11------11-------------------------1-1--------1-------11-------------1-----111------11---1----11-------1--11-------2----------12----1------1--1-------------------------1-1----12--1----12-----1-1--21------------------1--11--------1---------1-1-----21--22---111111111-111111----------1----------------------------2---------------1111121-----1111112-11112-----------------111111-1-11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 410 STR:RPRED 87.4 SQ:SECSTR ###########################################################HHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHGGGccEEEEEEEEEEEEcccccTTcEEEEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcTTTccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHGGGccEEEEEEEEEEEccEEEcTTcccccEEEEEEEEEEccccccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHTTEEEEEEccc DISOP:02AL 1-1,111-115,461-470| PSIPRED ccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHccccccHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccccccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccHHHcccccccc //