[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67283.1
DDBJ      :             ABC superfamily
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  363/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:248 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   102->180 PF01578 * Cytochrom_C_asm 5e-04 27.6 %
:HMM:PFM   16->187 PF01578 * Cytochrom_C_asm 1.4e-33 23.7 169/214  
:BLT:SWISS 4->248 CCMC_SHIFL e-122 82.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67283.1 GT:GENE ACF67283.1 GT:PRODUCT ABC superfamily GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2399180..2399926) GB:FROM 2399180 GB:TO 2399926 GB:DIRECTION - GB:PRODUCT ABC superfamily GB:NOTE identified by match to protein family HMM PF01578; match to protein family HMM TIGR01191 GB:PROTEIN_ID ACF67283.1 GB:DB_XREF GI:194407064 LENGTH 248 SQ:AASEQ MTTMWKTLHQLAAPPRLYQICGRLVPWLAAAGIIALATGWVRGFGFAPADYQQGEGYRIMYLHVPAAIWSMGIYAAMAVAAFTGLVWQMKMASLAVAAMAPVGAVYTFIALVTGAAWGKPMWGTWWVWDARLTSELVLLFLYAGVIALWHAFDDRKMAGRAAGILVLVGVVNLPVIHYSVEWWNTLHQGSTRMQQSIDPAMRSPLRWAIAGYLLLFMTLSLMRMRNLILLMEKRRPWVSELILKRGHR GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 4->248|CCMC_SHIFL|e-122|82.9|245/245| TM:NTM 6 TM:REGION 19->41| TM:REGION 62->84| TM:REGION 93->115| TM:REGION 131->153| TM:REGION 159->181| TM:REGION 202->223| SEG 27->40|wlaaagiialatgw| RP:PFM:NREP 1 RP:PFM:REP 102->180|PF01578|5e-04|27.6|76/212|Cytochrom_C_asm| HM:PFM:NREP 1 HM:PFM:REP 16->187|PF01578|1.4e-33|23.7|169/214|Cytochrom_C_asm| GO:PFM:NREP 3 GO:PFM GO:0006461|"GO:protein complex assembly"|PF01578|IPR002541| GO:PFM GO:0008535|"GO:respiratory chain complex IV assembly"|PF01578|IPR002541| GO:PFM GO:0016020|"GO:membrane"|PF01578|IPR002541| OP:NHOMO 408 OP:NHOMOORG 378 OP:PATTERN 11-1--------------1----11------1-----------------11-1--------------- 1111----------------------------------------------------------1----------------1-1---------------------------1------------------------1-1---1----1-------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------1--111111111111111111111111111111111-11111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-----------------------111221111-11----1-1---11-----1-------121111-----1111111111-1-----------11-----------------------------11-111111111111111111111111111---111-------11--1-1111111-111-111111111111111111111111---2222222222222221111111111-111111111111---1-----1111111-1111111111111111-------1111111111121111111111----------1111111111111111222221231111111-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------1--3-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 187-200,246-249| PSIPRED cHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccc //