[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67320.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  1/199 : Viruses  4/175   --->[See Alignment]
d.2.1
:177 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->127 2ikbD PDBj 7e-14 44.4 %
:RPS:SCOP  2->173 2ikbA1  d.2.1.9 * 7e-38 36.1 %
:RPS:PFM   4->88 PF05838 * DUF847 7e-20 61.0 %
:RPS:PFM   111->176 PF09374 * PG_binding_3 2e-12 56.7 %
:HMM:PFM   4->88 PF05838 * DUF847 4.1e-31 48.8 82/83  
:HMM:PFM   92->175 PF09374 * PG_binding_3 1.6e-26 45.7 70/72  
:BLT:SWISS 2->65 NDHH_EUCGG 7e-04 37.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67320.1 GT:GENE ACF67320.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(16494..17027) GB:FROM 16494 GB:TO 17027 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF05838; match to protein family HMM PF09374 GB:PROTEIN_ID ACF67320.1 GB:DB_XREF GI:194407101 LENGTH 177 SQ:AASEQ MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMRDLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFNHEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHNNEQFIYGWIKNRVT GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 2->65|NDHH_EUCGG|7e-04|37.3|59/100| BL:PDB:NREP 1 BL:PDB:REP 2->127|2ikbD|7e-14|44.4|108/159| RP:PFM:NREP 2 RP:PFM:REP 4->88|PF05838|7e-20|61.0|82/87|DUF847| RP:PFM:REP 111->176|PF09374|2e-12|56.7|60/74|PG_binding_3| HM:PFM:NREP 2 HM:PFM:REP 4->88|PF05838|4.1e-31|48.8|82/83|DUF847| HM:PFM:REP 92->175|PF09374|1.6e-26|45.7|70/72|PG_binding_3| RP:SCP:NREP 1 RP:SCP:REP 2->173|2ikbA1|7e-38|36.1|147/163|d.2.1.9| OP:NHOMO 93 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------1----11111131-----------------------------------------------1-1------------2------11-------11-------1-1----2----------------1111--------------------1-----------------1-----------------------------1--1------------1---1---------------------1--31-----------------1----------------1----1212122111121221----------1----------------------------------1-----1---433243--------------------------------1------------1-------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------1----------------111---------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 96.6 SQ:SECSTR #HHHHHHHccccccccccTTcGGGcEETTEEHHHHHTTTccccTcTTcHHHHHHHHHHHTTTTTTGGGcHHTHHHHHHHHHHHHHHHccHHHHHHHHHHHTcHcTHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHcTHHHHHHHH##### PSIPRED cHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHcHHHcccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcc //