[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67346.1
DDBJ      :             mannose binding protein FimH
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.2.3
:335 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   210->334 3bwuF PDBj 5e-11 18.3 %
:RPS:SCOP  195->334 1pdkB  b.2.3.2 * 2e-12 13.9 %
:HMM:SCOP  196->335 1n12A_ b.2.3.2 * 3.9e-19 23.3 %
:HMM:PFM   190->334 PF00419 * Fimbrial 1e-07 20.1 139/153  
:BLT:SWISS 19->335 FIMH_SALTY 8e-78 49.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67346.1 GT:GENE ACF67346.1 GT:PRODUCT mannose binding protein FimH GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 29625..30632 GB:FROM 29625 GB:TO 30632 GB:DIRECTION + GB:PRODUCT mannose binding protein FimH GB:NOTE identified by match to protein family HMM PF00419 GB:PROTEIN_ID ACF67346.1 GB:DB_XREF GI:194407127 LENGTH 335 SQ:AASEQ MKIPLLFALLAGSVVSQYAFADVCKNVNGVPSSINYDLTTTLTAEQNQVGKTVQLEKSQEVNVQAVCPAGAATYSQTYRSYVSPYPVVETSGNWKYLKLDPDYLEGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTVNISPKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGNFNHAGQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHVPQAIASDNADVGVVVETDEGNALIPNDAQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDFD GT:EXON 1|1-335:0| BL:SWS:NREP 1 BL:SWS:REP 19->335|FIMH_SALTY|8e-78|49.8|313/335| RP:PDB:NREP 1 RP:PDB:REP 210->334|3bwuF|5e-11|18.3|120/128| HM:PFM:NREP 1 HM:PFM:REP 190->334|PF00419|1e-07|20.1|139/153|Fimbrial| RP:SCP:NREP 1 RP:SCP:REP 195->334|1pdkB|2e-12|13.9|137/149|b.2.3.2| HM:SCP:REP 196->335|1n12A_|3.9e-19|23.3|129/0|b.2.3.2|1/1|Bacterial adhesins| OP:NHOMO 147 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---21355-3-1133-4333212424512333331----1--14242334334434324--122223----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 39.4 SQ:SECSTR ####################################################################################################################################################################################################cccEEcccc#cccccEEEEEccccccccc###cccEEEEEEEEEEcTTcc#EEEEEEEcccccccTTcEEccccTEEEEEEcTTcccccTTccGGGccEEEccTTccEEEEEEEEEEc#cccccccccccccEEEEEE# DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHccccccEEEcccccEEEEEEccccEEEcccccccEEEEEEEcccEEEEEEEcccccccEEEEEEEEcccccccccccEEEEEEccccEEEEEEEEEEccccccccHHHccccccccccccccEEEEccEEEEEEEEEEEEEEEEEEccEEEEEEEccccccccccccEEEEEEEEEEEEcccEEEcccEEEEEEcccccccEEEcccccccccEEEEEEEEEEccccccccEEEEEEEEEcccccccEEEccccccEEEEEEccccEEEcccccccEEccccccccccEEEEEEEEEccccccccccEEEEEEEEEEEc //