[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67354.1
DDBJ      :             putative esterase YbdB
Swiss-Prot:YBDB_ECOLI   RecName: Full=Esterase ybdB;         EC=3.1.-.-;AltName: Full=p15;

Homologs  Archaea  0/68 : Bacteria  262/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:137 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->137 1vh9A PDBj 2e-66 91.2 %
:RPS:PDB   2->131 2b6eA PDBj 2e-14 38.3 %
:RPS:SCOP  23->130 1zkiA1  d.38.1.5 * 5e-18 23.4 %
:HMM:SCOP  1->137 1vh9A_ d.38.1.5 * 2e-31 31.4 %
:HMM:PFM   50->127 PF03061 * 4HBT 3.3e-18 33.3 78/79  
:BLT:SWISS 1->137 YBDB_ECOLI 3e-66 92.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67354.1 GT:GENE ACF67354.1 GT:PRODUCT putative esterase YbdB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 709109..709522 GB:FROM 709109 GB:TO 709522 GB:DIRECTION + GB:PRODUCT putative esterase YbdB GB:NOTE identified by match to protein family HMM PF03061; match to protein family HMM TIGR00369 GB:PROTEIN_ID ACF67354.1 GB:DB_XREF GI:194407135 LENGTH 137 SQ:AASEQ MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFGLLHGGASAALAETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG GT:EXON 1|1-137:0| SW:ID YBDB_ECOLI SW:DE RecName: Full=Esterase ybdB; EC=3.1.-.-;AltName: Full=p15; SW:GN Name=ybdB; OrderedLocusNames=b0597, JW0589; SW:KW 3D-structure; Complete proteome; Hydrolase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->137|YBDB_ECOLI|3e-66|92.0|137/137| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 51->62|gllhggasaala| BL:PDB:NREP 1 BL:PDB:REP 1->137|1vh9A|2e-66|91.2|137/138| RP:PDB:NREP 1 RP:PDB:REP 2->131|2b6eA|2e-14|38.3|128/134| HM:PFM:NREP 1 HM:PFM:REP 50->127|PF03061|3.3e-18|33.3|78/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 23->130|1zkiA1|5e-18|23.4|107/126|d.38.1.5| HM:SCP:REP 1->137|1vh9A_|2e-31|31.4|137/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 325 OP:NHOMOORG 264 OP:PATTERN -------------------------------------------------------------------- ----1-----1-------------------------11---1-1-111-111111-11----1-1111111-----------------1111-1111----111-1111----------------11111111111---11---1--------------------------------------1--11---1-1111111111111111--1111111111----------------------------------------------------------------------------------------------------------------------------------1---------1-------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------1111-1111----------------11---1----1------------------1-----1-----------------------------111-1----111111111111111111111-------------222212-2222222222-223222222222222222222211111222222222222222212222222--111111111111----11111---------111111111111111------------1111-1111----1111----------111111111111111111111111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 100.0 SQ:SECSTR ccccccccHHHHHHHHcccHHHHTTcEEEEEccccccEEEEEccTTTcTTccccHHHHHHHHHHHHHHHHHHTccTTcEEEEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEcTTccEEEEEEEEEEccc PSIPRED ccccccccHHHHHHHccccHHHHcccEEEEEEccEEEEEEEccHHHHccccEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEEEc //