[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67373.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:64 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->61 2k2pA PDBj 4e-09 41.0 %
:RPS:PDB   1->62 1afiA PDBj 7e-11 27.4 %
:RPS:SCOP  1->61 1sb6A  d.58.17.1 * 2e-13 31.1 %
:HMM:SCOP  1->62 1mwzA_ d.58.17.1 * 9.7e-12 29.0 %
:HMM:PFM   3->59 PF00403 * HMA 1.1e-15 28.1 57/62  
:BLT:SWISS 7->58 ATOX1_DICDI 3e-05 32.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67373.1 GT:GENE ACF67373.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 448529..448723 GB:FROM 448529 GB:TO 448723 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF00403 GB:PROTEIN_ID ACF67373.1 GB:DB_XREF GI:194407154 LENGTH 64 SQ:AASEQ MQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER GT:EXON 1|1-64:0| BL:SWS:NREP 1 BL:SWS:REP 7->58|ATOX1_DICDI|3e-05|32.7|52/67| BL:PDB:NREP 1 BL:PDB:REP 1->61|2k2pA|4e-09|41.0|61/64| RP:PDB:NREP 1 RP:PDB:REP 1->62|1afiA|7e-11|27.4|62/72| HM:PFM:NREP 1 HM:PFM:REP 3->59|PF00403|1.1e-15|28.1|57/62|HMA| RP:SCP:NREP 1 RP:SCP:REP 1->61|1sb6A|2e-13|31.1|61/64|d.58.17.1| HM:SCP:REP 1->62|1mwzA_|9.7e-12|29.0|62/0|d.58.17.1|1/1|HMA, heavy metal-associated domain| OP:NHOMO 43 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------1--1---------------------------------------------------------------------------------------111-1-----11-------111--------------1-1-----------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------111-1111111-1--1-------------------------------------------------------111111------1112-------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 100.0 SQ:SECSTR EEEEcTTcccccHHHHHHHHHHTTccEEEEEEETTTTEEEEETTccHHHHHHHHHHHTcccEEE DISOP:02AL 61-65| PSIPRED cEEEEccccHHHHHHHHHHHHHHccccEEEEEEccccEEEEEEcccHHHHHHHHHHcccccccc //