[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67377.1
DDBJ      :             chaperone protein FimC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  153/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.1.11b.7.2
:227 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->218 2co6B PDBj 2e-44 45.3 %
:RPS:PDB   24->226 3dosD PDBj 6e-56 39.5 %
:RPS:SCOP  24->142 1kiuA1  b.1.11.1 * 2e-31 44.8 %
:RPS:SCOP  145->226 1p5uA2  b.7.2.1 * 6e-21 32.1 %
:HMM:SCOP  17->142 1p5vA1 b.1.11.1 * 2.8e-40 46.4 %
:HMM:SCOP  136->226 1p5vA2 b.7.2.1 * 1.5e-22 42.2 %
:RPS:PFM   24->142 PF00345 * Pili_assembly_N 1e-24 47.9 %
:RPS:PFM   162->222 PF02753 * Pili_assembly_C 4e-10 50.8 %
:HMM:PFM   23->142 PF00345 * Pili_assembly_N 2.2e-43 45.8 118/122  
:HMM:PFM   162->223 PF02753 * Pili_assembly_C 1.1e-24 48.4 62/68  
:BLT:SWISS 24->226 PSAB_YERPS 1e-40 43.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67377.1 GT:GENE ACF67377.1 GT:PRODUCT chaperone protein FimC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(208070..208753) GB:FROM 208070 GB:TO 208753 GB:DIRECTION - GB:PRODUCT chaperone protein FimC GB:NOTE identified by match to protein family HMM PF00345; match to protein family HMM PF02753 GB:PROTEIN_ID ACF67377.1 GB:DB_XREF GI:194407158 LENGTH 227 SQ:AASEQ MNSLAKAGLLCCLLCGSLAHAAGINIGTTRVIFHGDAKDTSISISNNDNVPYLIQSWAQSISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGGNLPEDRESLYWLDIKSIPSSNPDNKHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGRTLTVKNPTPYYMNFATLSVGSQKVKAPRYVAPFGNAQYTLPAAASGTIVWSIINDFGGTGPEHKQTP GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 24->226|PSAB_YERPS|1e-40|43.5|200/273| TM:NTM 1 TM:REGION 4->26| SEG 4->23|lakagllccllcgslahaag| BL:PDB:NREP 1 BL:PDB:REP 24->218|2co6B|2e-44|45.3|190/208| RP:PDB:NREP 1 RP:PDB:REP 24->226|3dosD|6e-56|39.5|185/191| RP:PFM:NREP 2 RP:PFM:REP 24->142|PF00345|1e-24|47.9|117/122|Pili_assembly_N| RP:PFM:REP 162->222|PF02753|4e-10|50.8|61/67|Pili_assembly_C| HM:PFM:NREP 2 HM:PFM:REP 23->142|PF00345|2.2e-43|45.8|118/122|Pili_assembly_N| HM:PFM:REP 162->223|PF02753|1.1e-24|48.4|62/68|Pili_assembly_C| GO:PFM:NREP 6 GO:PFM GO:0005515|"GO:protein binding"|PF00345|IPR016147| GO:PFM GO:0007047|"GO:cellular cell wall organization"|PF00345|IPR016147| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00345|IPR016147| GO:PFM GO:0005515|"GO:protein binding"|PF02753|IPR016148| GO:PFM GO:0007047|"GO:cellular cell wall organization"|PF02753|IPR016148| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF02753|IPR016148| RP:SCP:NREP 2 RP:SCP:REP 24->142|1kiuA1|2e-31|44.8|116/121|b.1.11.1| RP:SCP:REP 145->226|1p5uA2|6e-21|32.1|81/87|b.7.2.1| HM:SCP:REP 17->142|1p5vA1|2.8e-40|46.4|125/0|b.1.11.1|1/1|PapD-like| HM:SCP:REP 136->226|1p5vA2|1.5e-22|42.2|83/86|b.7.2.1|1/1|Periplasmic chaperone C-domain| OP:NHOMO 933 OP:NHOMOORG 155 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111371111421111111-3333211121215--22------2------------1-------------------------------------------------------------------------11-------------1----112----2---------------F7--24DAEEBABB8CA-D99H948DBDE8C99A997EA9127FFE5CDCDEEDEDDDDDC74345687--9BBBAB99BAAA--------------1---------1---11---22212-3--1--6746-313-1131-333-------------------1----21--------1111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 89.4 SQ:SECSTR #######################EEEcccEEEEETTcccEEEEEEEcccccEEEEEEEEETTcccccccccEEEEccEEEEcTTcEEEEEEEEccccccccccEEEEEEEEEEccccccccccccccccEEEEEEEEEcTTccccGGGTGGGcEEEEcccEEEEEEcccccEEEEEEEETTEEcccccEEcTTEEEEEEccTcccccEEEEEccTTccccccEEEc# DISOP:02AL 1-1,116-123,221-228| PSIPRED ccHHHHHHHHHHHHHHHHHHcccEEEccEEEEEcccccEEEEEEEEcccccEEEEEEEEccccccccccccEEEEccEEEEccccccEEEEEEcccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEEEEEcccccccHHHHHHEEEEEEEccEEEEEccccEEEEEEEEEEccEEcccccEEcccccEEEEEEcccccEEEEEEEEccccccccccccc //