[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67400.1
DDBJ      :             putative inner membrane protein
Swiss-Prot:YOAI_SALTY   RecName: Full=Uncharacterized protein yoaI;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:47 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 13->47 YOAI_SALTY 8e-05 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67400.1 GT:GENE ACF67400.1 GT:PRODUCT putative inner membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1362623..1362766 GB:FROM 1362623 GB:TO 1362766 GB:DIRECTION + GB:PRODUCT putative inner membrane protein GB:PROTEIN_ID ACF67400.1 GB:DB_XREF GI:194407181 LENGTH 47 SQ:AASEQ MNRHCCLPEDTIMYDPPFLEALMITASFFAIFIIIVVSVLLLEGGGD GT:EXON 1|1-47:0| SW:ID YOAI_SALTY SW:DE RecName: Full=Uncharacterized protein yoaI; SW:GN Name=yoaI; OrderedLocusNames=STM1281; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 13->47|YOAI_SALTY|8e-05|100.0|35/35| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 15->37| SEG 26->42|asffaifiiivvsvlll| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,46-48| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //