[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67404.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->49 PF03273 * Baculo_gp64 0.00034 27.9 43/517  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67404.1 GT:GENE ACF67404.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1362440..1362592 GB:FROM 1362440 GB:TO 1362592 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67404.1 GB:DB_XREF GI:194407185 LENGTH 50 SQ:AASEQ MTSNIMVSLPKSKPDYFTPKRQSAQAFLTIDADFRQLPERQSLREKRRCH GT:EXON 1|1-50:0| HM:PFM:NREP 1 HM:PFM:REP 7->49|PF03273|0.00034|27.9|43/517|Baculo_gp64| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-111-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,6-7,40-51| PSIPRED ccccEEEEccccccccccccccccEEEEEEcHHHHHccHHHHHHHHHccc //