[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67422.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->44 PF07484 * Collar 6.4e-05 40.0 25/57  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67422.1 GT:GENE ACF67422.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1357991..1358176 GB:FROM 1357991 GB:TO 1358176 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67422.1 GB:DB_XREF GI:194407203 LENGTH 61 SQ:AASEQ MGYKLNHSVLIKIIVIINDCNPDIYALLSTTLKGDGYHKLHFPDDVLFFLTANKPLTLRHK GT:EXON 1|1-61:0| HM:PFM:NREP 1 HM:PFM:REP 19->44|PF07484|6.4e-05|40.0|25/57|Collar| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,59-62| PSIPRED cccccccEEEEEEEEEEEcccccHHHHHHHHcccccEEEEEccccEEEEEEccccEEEEEc //