[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67429.1
DDBJ      :             protein YfjF
Swiss-Prot:YFJF_SALTY   RecName: Full=UPF0125 protein yfjF;

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->81 2hj1B PDBj 3e-23 53.2 %
:RPS:PDB   7->78 3biiD PDBj 1e-11 16.7 %
:RPS:SCOP  3->79 2hj1A1  d.15.3.4 * 5e-15 51.9 %
:RPS:PFM   7->88 PF03658 * UPF0125 3e-23 72.0 %
:HMM:PFM   6->88 PF03658 * UPF0125 4.2e-40 66.3 83/84  
:BLT:SWISS 1->96 YFJF_SALTY 6e-50 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67429.1 GT:GENE ACF67429.1 GT:PRODUCT protein YfjF GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2833775..2834065) GB:FROM 2833775 GB:TO 2834065 GB:DIRECTION - GB:PRODUCT protein YfjF GB:NOTE identified by match to protein family HMM PF03658 GB:PROTEIN_ID ACF67429.1 GB:DB_XREF GI:194407210 LENGTH 96 SQ:AASEQ MPDKLVVEVAYALPEKQYLQRVTLEEGATVEEAIRASGLLELRTDIDLAKNKVGIYSRPVKLTDTVQDGDRVEIYRPLIADPKALRRQRAEKSAGR GT:EXON 1|1-96:0| SW:ID YFJF_SALTY SW:DE RecName: Full=UPF0125 protein yfjF; SW:GN Name=yfjF; OrderedLocusNames=STM2686; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->96|YFJF_SALTY|6e-50|100.0|96/96| BL:PDB:NREP 1 BL:PDB:REP 3->81|2hj1B|3e-23|53.2|79/80| RP:PDB:NREP 1 RP:PDB:REP 7->78|3biiD|1e-11|16.7|72/80| RP:PFM:NREP 1 RP:PFM:REP 7->88|PF03658|3e-23|72.0|82/84|UPF0125| HM:PFM:NREP 1 HM:PFM:REP 6->88|PF03658|4.2e-40|66.3|83/84|UPF0125| RP:SCP:NREP 1 RP:SCP:REP 3->79|2hj1A1|5e-15|51.9|77/77|d.15.3.4| OP:NHOMO 261 OP:NHOMOORG 255 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------1------------------------------------11----1111111111111111111111111111-----11------1--1121111111111111111222-----------------------------------------------------------1111111111111111111111111111111-111211--11111111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111---1111111111111-11111111111111111111111----1111111111----2-1-111-11111111111111111111--------------111-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 82.3 SQ:SECSTR ##cEEEEEEcHHHHHHHcccEEEEcccccHHHHHHHHHTTHHHHHHccTTcEEEETTEEccTTccccTTcEEEEEcccccc############### DISOP:02AL 1-3,86-97| PSIPRED cccEEEEEEEEEcccccEEEEEEEccccHHHHHHHHccHHHHcccccHHHcccEEEEEEccHHHccccccEEEEEccccccHHHHHHHHHHHHHcc //