[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67435.1
DDBJ      :             LysR substrate binding domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  573/915 : Eukaryota  10/199 : Viruses  1/175   --->[See Alignment]
a.4.5c.94.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->297 3hhgG PDBj 2e-39 35.2 %
:RPS:PDB   6->115 1b9mA PDBj 2e-17 12.8 %
:RPS:PDB   88->300 1al3A PDBj 1e-25 14.9 %
:RPS:SCOP  1->105 1b9mA1  a.4.5.8 * 2e-20 14.3 %
:RPS:SCOP  93->296 1ixcA2  c.94.1.1 * 7e-24 13.1 %
:HMM:SCOP  6->114 1b9mA1 a.4.5.8 * 1.8e-20 36.9 %
:HMM:SCOP  88->303 1uthA_ c.94.1.1 * 2.4e-42 32.9 %
:RPS:PFM   6->65 PF00126 * HTH_1 1e-09 45.0 %
:RPS:PFM   91->294 PF03466 * LysR_substrate 7e-17 34.0 %
:HMM:PFM   89->295 PF03466 * LysR_substrate 2.3e-39 32.7 202/209  
:HMM:PFM   6->65 PF00126 * HTH_1 3.5e-20 45.0 60/60  
:BLT:SWISS 3->295 YHJC_ECOLI 3e-53 36.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67435.1 GT:GENE ACF67435.1 GT:PRODUCT LysR substrate binding domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1677595..1678503 GB:FROM 1677595 GB:TO 1678503 GB:DIRECTION + GB:PRODUCT LysR substrate binding domain protein GB:NOTE identified by match to protein family HMM PF00126; match to protein family HMM PF03466 GB:PROTEIN_ID ACF67435.1 GB:DB_XREF GI:194407216 LENGTH 302 SQ:AASEQ MQLNMLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSMTDEGEEFYQRCLSLLSELDDVRRLFSSTQPPKGRLRLDVPITLARAVIIPALGDFQNRYPDIEIVLGTSDRKIDLIAERVDCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPHSIDELMKSHRAVNFFSNHSLQIMEWKFTVDGSIASIKIPSSILVDNSEAFLSCGLAGLGVLHGLRPSLAPFIASGELTEILTDFPPPPKPVSLLYPDRRYLAPKVRVFIDWLCEVFGPDAHL GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 3->295|YHJC_ECOLI|3e-53|36.3|292/299| SEG 265->270|ppppkp| BL:PDB:NREP 1 BL:PDB:REP 7->297|3hhgG|2e-39|35.2|287/294| RP:PDB:NREP 2 RP:PDB:REP 6->115|1b9mA|2e-17|12.8|109/255| RP:PDB:REP 88->300|1al3A|1e-25|14.9|208/237| RP:PFM:NREP 2 RP:PFM:REP 6->65|PF00126|1e-09|45.0|60/60|HTH_1| RP:PFM:REP 91->294|PF03466|7e-17|34.0|194/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 89->295|PF03466|2.3e-39|32.7|202/209|LysR_substrate| HM:PFM:REP 6->65|PF00126|3.5e-20|45.0|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->105|1b9mA1|2e-20|14.3|105/122|a.4.5.8| RP:SCP:REP 93->296|1ixcA2|7e-24|13.1|199/205|c.94.1.1| HM:SCP:REP 6->114|1b9mA1|1.8e-20|36.9|103/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 88->303|1uthA_|2.4e-42|32.9|210/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 7542 OP:NHOMOORG 584 OP:PATTERN -------------------------------------------------------------------- 1-2-1-----1---21-----1---3------1----455-112-11-----1-1--3--1---1-333-----------1-211---11-------------------1--------------------------111-1---1162133312212--1-1-2418211111--11111-11--------325444447531333584213368445132621-12212299-11-1111-111111122-4-2--11-1-1---22--1-2----------------------------------------------------235333234313112221111411--112-1554311-1421-1----21-K55611111O7WPP64B8D5C66685568678M-DJHDAQEJHg51uccGafRzukccPJ6777DG65799CB55555555AHI7984A-----------------------------1-6D85CcUKg******ZSUVRvv**efffPl*v*aswe--cXZEBICBuHUHy79PA5669a822222221224I95211---11-5223-1---23-2-8B4B5K12--1----------------------33SJK996b6IG6GMNMKCJKLGIGMKIQHYO---23-3------GHCQ3MHIIIFIFEDGG-IGHGJECGHEIFKGGHHG8kwjNK59AG8GEGFGGFHEEEEEDkCB9778C4-I99AAAA89AAA---2-2--2445423TJQ878E3I122314212QQQQSBI597b4jlgkapqkScdegCTTW5653366462GOOaHGHHGMRRKIXYGIKIG3334111--2------------------------------------------------------21 -----------------------------------------------------------------------------------------------------------------------------------------------1--------------5----3------F--6-1--------11--9-----7---- --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- STR:NPRED 300 STR:RPRED 99.3 SQ:SECSTR EEETTEEEEcHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcTccccEEEEEEEEcHHHHHHTcHHHHHHHHHHcTEEEEEccHHHHHHHHHTTcccEEEEccccTTccEEEEEEEEEcEEEEEcTTcTTTTTccccHHHHHTcEEEEEcTTcTEEEcTHHHHHHHHHHHTcccEEEEEEccHHHHHHHHHHTccEEEEEEGGGccTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTccHHH## DISOP:02AL 1-1,85-89,299-303| PSIPRED cccccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHccccEEcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEccEEccccccccEEEEEcccccccEEEEEEccccEEEEEcHHHHHHccccccHHHHHccccEEEEccccccccccEEEEEccEEEEEEccccEEEccHHHHHHHHHccccEEEccHHHHHHHHHccccEEEccccccccccEEEEccccccccHHHHHHHHHHHHHHcccccc //