[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67439.1
DDBJ      :             competence damage-inducible protein A
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  400/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.51.5
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->170 2a9sB PDBj 2e-11 30.4 %
:RPS:PDB   14->172 2a9sA PDBj 2e-30 25.8 %
:RPS:SCOP  15->170 2a9sA1  c.51.5.1 * 1e-30 27.6 %
:HMM:SCOP  10->174 2a9sA1 c.51.5.1 * 1.9e-40 38.2 %
:RPS:PFM   17->171 PF02464 * CinA 3e-23 38.7 %
:HMM:PFM   18->168 PF02464 * CinA 1e-50 39.7 151/155  
:BLT:SWISS 1->153 YDEJ_ECOLI 1e-38 58.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67439.1 GT:GENE ACF67439.1 GT:PRODUCT competence damage-inducible protein A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1639515..1640042) GB:FROM 1639515 GB:TO 1640042 GB:DIRECTION - GB:PRODUCT competence damage-inducible protein A GB:NOTE identified by match to protein family HMM PF02464; match to protein family HMM TIGR00199 GB:PROTEIN_ID ACF67439.1 GB:DB_XREF GI:194407220 LENGTH 175 SQ:AASEQ MRLEQHDIVTLDEAESVDSLTKKLGDLLVNQKLRLTTAESCTGGKLASALCAAEDTPSFYGVGYVTFTDEAKAKILRVQRHSLAEHTAVSEAVVTEMAQGAKDQAEVNISIAISGYGGPEGGEDGTPAGTVWFAWNINNTTFTSRQHFNGDCQEVLEKCVRFALAELLFLLTKKA GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 1->153|YDEJ_ECOLI|1e-38|58.2|153/172| SEG 115->130|gyggpeggedgtpagt| BL:PDB:NREP 1 BL:PDB:REP 33->170|2a9sB|2e-11|30.4|138/165| RP:PDB:NREP 1 RP:PDB:REP 14->172|2a9sA|2e-30|25.8|159/167| RP:PFM:NREP 1 RP:PFM:REP 17->171|PF02464|3e-23|38.7|155/155|CinA| HM:PFM:NREP 1 HM:PFM:REP 18->168|PF02464|1e-50|39.7|151/155|CinA| RP:SCP:NREP 1 RP:SCP:REP 15->170|2a9sA1|1e-30|27.6|156/167|c.51.5.1| HM:SCP:REP 10->174|2a9sA1|1.9e-40|38.2|165/0|c.51.5.1|1/1|CinA-like| OP:NHOMO 467 OP:NHOMOORG 407 OP:PATTERN ------------------------111-1--1------------------------------------ -------------------------1----------------------------------------------------11-11-11--111--1111-----11-1-1-1----------------111-----11-----------1-1---11-----------1-------------------------------------------------------------------------------------------------11------1--------------------------------------------------1-111111111111111111111-11--11-1-11--11---11111-1----1111--1----111111--11-111111111---1-1-111-1-1-111-11111-1----1--1---11-1111111111----1111----------11------------------1-1--1111-1111112111111121111111121111-11111111111-11111-111-1111111111112211111-11---1111----1111---------11-------------1------1--1--11111111-111111111111111111111---1111------12111212221211122-2222111212211222222232111112222222222222222-2222222--111111111111---1-----111111111-------------------------1111111221122211111---------111111111111111--1111111111111--1--1111-----------------------1-----1------111--1-111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 90.9 SQ:SECSTR #############cHHHHHHHHHHHHHHHHHTccEEEEEcTTTTHHHHHHTTcTTGGGTEEEEEEcccHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHTccccEEEEEEEccccccccccccTTEEEEEEEETTEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHH### DISOP:02AL 1-6,174-176| PSIPRED cccccccEEEccccHHHHHHHHHHHHHHHHcccEEEEHHHHcHHHHHHHHHcccccHHHHcccEEEEcHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccEEEEEEEEcccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHc //