[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67466.1
DDBJ      :             putative cytoplasmic protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  41/915 : Eukaryota  12/199 : Viruses  2/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67466.1 GT:GENE ACF67466.1 GT:PRODUCT putative cytoplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2803977..2804432) GB:FROM 2803977 GB:TO 2804432 GB:DIRECTION - GB:PRODUCT putative cytoplasmic protein GB:PROTEIN_ID ACF67466.1 GB:DB_XREF GI:194407247 LENGTH 151 SQ:AASEQ MAIKPFNYQQDFSSIDFRQQPELYQVGRGEQGVLLVEPYKSEILPFWRYKDEASAMKSAEQIYQLFEAYRQQDDFVGMDMARKFIQMGYTRARRYANYKGGKKYAEDGSLNTRGNDPIKAAAATVFKGWWDKIRQDEDYLKRKRQHQARWG GT:EXON 1|1-151:0| OP:NHOMO 56 OP:NHOMOORG 56 OP:PATTERN ----------------------------1--------------------------------------- ------------------------------------------------------------------------------------------------1----------11---------------------------------------1-----------------11-1-------------111-------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1--------------------------------------1111111111111111--------------------------------------1----------------------1111-------------------------------------------------------------------------------------------------------------------- ---------------1111-------------------------------11-1--------------------------------------1------11-1--------------------------------------------------------------------------------------1--------- -----1------------------1------------------------------------------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-3,100-120,147-152| PSIPRED ccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcc //