[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67524.1
DDBJ      :             CysZ protein
Swiss-Prot:CYSZ_SALTI   RecName: Full=Protein cysZ;

Homologs  Archaea  0/68 : Bacteria  177/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:287 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   106->274 PF04401 * DUF540 2e-34 51.2 %
:HMM:PFM   90->275 PF04401 * DUF540 7.5e-71 47.2 180/188  
:BLT:SWISS 35->287 CYSZ_SALTI e-152 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67524.1 GT:GENE ACF67524.1 GT:PRODUCT CysZ protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2600007..2600870 GB:FROM 2600007 GB:TO 2600870 GB:DIRECTION + GB:PRODUCT CysZ protein GB:NOTE identified by match to protein family HMM PF04401 GB:PROTEIN_ID ACF67524.1 GB:DB_XREF GI:194407305 LENGTH 287 SQ:AASEQ MLFFRTFPNYPPSDNRVRYPTFTQGFKKKEYVLNMVSSSTTVPRSGVYYFSQGWKLVTLPGIRRFVILPLLVNIVLMGGAFWWLFTQLDAWIPSLMSHVPDWLQWLSYLLWPIAVISVLLVFGYFFSTLANWIAAPFNGLLAEQLEARLTGATPPDTGILGIMKDVPRIMKREWQKLAWYLPRAIVLLVLYFIPGIGQTIAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMRAALRTQKVANMQFGALTSLFTMIPVLNLFIMPVAVCGATAMWVDCWRAKHALWK GT:EXON 1|1-287:0| SW:ID CYSZ_SALTI SW:DE RecName: Full=Protein cysZ; SW:GN Name=cysZ; OrderedLocusNames=STY2665, t0428; SW:KW Amino-acid biosynthesis; Cell inner membrane; Cell membrane;Complete proteome; Cysteine biosynthesis; Membrane; Transmembrane;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 35->287|CYSZ_SALTI|e-152|100.0|253/253| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0019344|"GO:cysteine biosynthetic process"|Cysteine biosynthesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 4 TM:REGION 65->87| TM:REGION 111->133| TM:REGION 189->211| TM:REGION 251->273| RP:PFM:NREP 1 RP:PFM:REP 106->274|PF04401|2e-34|51.2|164/177|DUF540| HM:PFM:NREP 1 HM:PFM:REP 90->275|PF04401|7.5e-71|47.2|180/188|DUF540| GO:PFM:NREP 3 GO:PFM GO:0009276|"GO:Gram-negative-bacterium-type cell wall"|PF04401|IPR007496| GO:PFM GO:0016021|"GO:integral to membrane"|PF04401|IPR007496| GO:PFM GO:0019344|"GO:cysteine biosynthetic process"|PF04401|IPR007496| OP:NHOMO 178 OP:NHOMOORG 177 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1-----------------------------------------------------------------------1111--------1--------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------1------------------------------------111111111111111111111111111111---1--1------11111111111111111-1111111111111111111111111111111111111111111111111111-111112111111---1---------11111111111111111111----------1111111111111111111----------11111111111111----------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 35-36,39-43,150-150,152-152,155-155| PSIPRED ccccccccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //