[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67528.1
DDBJ      :             putative DNA transfer protein gp7
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:230 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->167 VG07_BPHK6 9e-59 89.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67528.1 GT:GENE ACF67528.1 GT:PRODUCT putative DNA transfer protein gp7 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 405603..406295 GB:FROM 405603 GB:TO 406295 GB:DIRECTION + GB:PRODUCT putative DNA transfer protein gp7 GB:PROTEIN_ID ACF67528.1 GB:DB_XREF GI:194407309 LENGTH 230 SQ:AASEQ MLYAFTLGRKLRGEEPSYPEKGGKGGSSDKSAKYAAEAQKYAADLQNQQWQTIMKNLAPFTPLAEQYVNQLQNLSSLEGQGQALNQYYNSQQYKDLAGQARYQSLAAAEATGGLGSTATSNQLATIAPTLGQSWLSNQMSNYNNLANVGLGALQGQANAGQTYANNMSSIAQQSAALAAANANKPSSLQTAISGGTSGAIAGAGLASLLGTSTPWGAGIGAGIGLLGSLF GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 1->167|VG07_BPHK6|9e-59|89.8|167/230| SEG 21->43|kggkggssdksakyaaeaqkyaa| SEG 149->161|glgalqgqanagq| SEG 168->188|ssiaqqsaalaaanankpssl| SEG 190->213|taisggtsgaiagaglasllgtst| SEG 216->227|gagigagigllg| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-1-111--------111------1---------1-11---1-1---11----111-1---------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------1------------1-----11------------------------------------1----------------------------------------------------------------------------- DISOP:02AL 18-42,178-181| PSIPRED ccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHccccccccHHHHHHHHHHHHHc //