[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67551.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.268.1
:149 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->126 1vk1A  d.268.1.2 * 2e-05 15.7 %
:HMM:PFM   29->100 PF02195 * ParBc 5.5e-06 28.6 63/90  
:HMM:PFM   82->121 PF09529 * Intg_mem_TP0381 0.00038 27.5 40/225  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67551.1 GT:GENE ACF67551.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1111582..1112031 GB:FROM 1111582 GB:TO 1112031 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67551.1 GB:DB_XREF GI:194407332 LENGTH 149 SQ:AASEQ MITALDIEKVITDKGPMSNIKGPLISSQRYLDKAKVSDRAARFKRFIVSVYPIVLRGQQYTILMDGHHNYAAAKLAGIEPDYRPITKKVQRILGEMSWREREAFFINNVTDSNYYFVETGEVVHELVMPDTSCKFHAHAGNQWIFGGAA GT:EXON 1|1-149:0| HM:PFM:NREP 2 HM:PFM:REP 29->100|PF02195|5.5e-06|28.6|63/90|ParBc| HM:PFM:REP 82->121|PF09529|0.00038|27.5|40/225|Intg_mem_TP0381| RP:SCP:NREP 1 RP:SCP:REP 5->126|1vk1A|2e-05|15.7|108/232|d.268.1.2| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccEEEHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccEEEEEEccccccHHHHHccccccccHHHHHHHHHHHHcccccccEEEEEccccccEEEEEHHHHHHHHHccccccEEEEcccccEEEcccc //