[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67568.1
DDBJ      :             virulence membrane protein PagC
Swiss-Prot:PAGC_SALTY   RecName: Full=Virulence membrane protein pagC;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
f.4.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->185 1qj8A PDBj 2e-24 43.4 %
:RPS:PDB   94->183 3dzmC PDBj 2e-04 6.7 %
:RPS:SCOP  29->185 1qj8A  f.4.1.1 * 2e-13 42.6 %
:HMM:SCOP  12->185 1qj8A_ f.4.1.1 * 6.5e-24 27.2 %
:RPS:PFM   21->185 PF06316 * Ail_Lom 2e-26 46.6 %
:HMM:PFM   4->185 PF06316 * Ail_Lom 3.1e-30 33.7 181/199  
:BLT:SWISS 21->185 PAGC_SALTY 3e-94 100.0 %
:PROS 45->53|PS00694|ENT_VIR_OMP_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67568.1 GT:GENE ACF67568.1 GT:PRODUCT virulence membrane protein PagC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1337293..1337850 GB:FROM 1337293 GB:TO 1337850 GB:DIRECTION + GB:PRODUCT virulence membrane protein PagC GB:NOTE identified by match to protein family HMM PF06316 GB:PROTEIN_ID ACF67568.1 GB:DB_XREF GI:194407349 LENGTH 185 SQ:AASEQ MKNIILSTLVITTSVLVVNVAQADTNAFSVGYAQSKVQDFKNIRGVNVKYRYEDDSPVSFISSLSYLYGDRQASGSVEPEGIHYHDKFEVKYGSLMVGPAYRLSDNFSLYALAGVGTVKATFKEHSTQDGDSFSNKISSRKTGFAWGAGVQMNPLENIVVDVGYEGSNISSTKINGFNVGVGYRF GT:EXON 1|1-185:0| SW:ID PAGC_SALTY SW:DE RecName: Full=Virulence membrane protein pagC;Flags: Precursor; SW:GN Name=pagC; OrderedLocusNames=STM1246; SW:KW Cell membrane; Cell outer membrane; Complete proteome; Membrane;Signal; Transmembrane; Virulence. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 21->185|PAGC_SALTY|3e-94|100.0|165/185| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| PROS 45->53|PS00694|ENT_VIR_OMP_1|PDOC00582| SEG 3->20|niilstlvittsvlvvnv| BL:PDB:NREP 1 BL:PDB:REP 25->185|1qj8A|2e-24|43.4|145/148| RP:PDB:NREP 1 RP:PDB:REP 94->183|3dzmC|2e-04|6.7|89/202| RP:PFM:NREP 1 RP:PFM:REP 21->185|PF06316|2e-26|46.6|161/184|Ail_Lom| HM:PFM:NREP 1 HM:PFM:REP 4->185|PF06316|3.1e-30|33.7|181/199|Ail_Lom| GO:PFM:NREP 1 GO:PFM GO:0009279|"GO:cell outer membrane"|PF06316|IPR000758| RP:SCP:NREP 1 RP:SCP:REP 29->185|1qj8A|2e-13|42.6|141/148|f.4.1.1| HM:SCP:REP 12->185|1qj8A_|6.5e-24|27.2|147/0|f.4.1.1|1/1|OMPA-like| OP:NHOMO 284 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11112211CB3131422-F215263355E43222222211222324243544454447435144132322-244443444444--1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------1--1----1--------111------------------ STR:NPRED 151 STR:RPRED 81.6 SQ:SECSTR ########################EEEEEEEEEEEEETTTEEEEEEEEEEEEEcTccEEEEEEEEEEEEEEEcTTc#########cEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEEcccccccccEEEEEEEE#EEEEEEEEEEEEEETTEEEEEEEEEEEEccccEEEEEEcTTcEc DISOP:02AL 1-1,133-135| PSIPRED cHHHHHHHHHHHHHHcccHHccccccEEEEEEEEccccccccccEEEEEEEEEEcccEEEEEEEEEccccccccccccccccEEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEcccccccccccccccccccEEEEEEEEEEEEcccEEEEEEEEEcccccEEEcEEEEEEEEEc //