[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67572.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->77 PF10678 * DUF2492 1e-24 81.6 %
:HMM:PFM   1->78 PF10678 * DUF2492 2.2e-37 56.4 78/78  
:BLT:SWISS 1->79 YECH_ECOLI 2e-36 87.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67572.1 GT:GENE ACF67572.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2078281..2078520) GB:FROM 2078281 GB:TO 2078520 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67572.1 GB:DB_XREF GI:194407353 LENGTH 79 SQ:AASEQ MDSIHGHEVLNMMIESGEQYTHTSLEAAIKARFGERARFHTCSASDMTAAELVAFLAAKGKFIAVEDGFSTHESKICRH GT:EXON 1|1-79:0| BL:SWS:NREP 1 BL:SWS:REP 1->79|YECH_ECOLI|2e-36|87.3|79/100| RP:PFM:NREP 1 RP:PFM:REP 2->77|PF10678|1e-24|81.6|76/78|DUF2492| HM:PFM:NREP 1 HM:PFM:REP 1->78|PF10678|2.2e-37|56.4|78/78|DUF2492| OP:NHOMO 88 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------1--1----------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------11111-11-1111111111-------------1-1111-1111111-11-111111111111111111111111--11111111111111111-1111111---------------------------------------------------------------------------------------111----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,74-74,78-80| PSIPRED cccHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccccccccccccccHHHHHcc //