[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67603.1
DDBJ      :             glutathione-dependent formaldehyde-activating, GFA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  99/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.88.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->48 2z7kA PDBj 5e-04 35.6 %
:RPS:SCOP  3->121 1x6mA  b.88.1.4 * 5e-12 15.1 %
:HMM:SCOP  1->132 1x6mA_ b.88.1.4 * 9e-29 31.2 %
:RPS:PFM   27->82 PF04828 * GFA 9e-07 47.3 %
:HMM:PFM   25->114 PF04828 * GFA 2.2e-17 27.9 86/92  
:BLT:SWISS 1->91 YEMD_SCHPO 7e-10 32.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67603.1 GT:GENE ACF67603.1 GT:PRODUCT glutathione-dependent formaldehyde-activating, GFA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1705193..1705633 GB:FROM 1705193 GB:TO 1705633 GB:DIRECTION + GB:PRODUCT glutathione-dependent formaldehyde-activating, GFA GB:NOTE identified by match to protein family HMM PF04828 GB:PROTEIN_ID ACF67603.1 GB:DB_XREF GI:194407384 LENGTH 146 SQ:AASEQ MQTFTGRCLCGQSHFTVDVEMLDVYACHCTLCQKWSGGIAMYLEACGQPQLAPLSPEPPYFSSSSRGERYFCSGCGCPLWFRLTDTDRYFIPWTLLELNEVDRRRLILAAEIYTETQPAFWRLTGQYARLSGKEVEEMDSPCQLAH GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 1->91|YEMD_SCHPO|7e-10|32.2|90/137| BL:PDB:NREP 1 BL:PDB:REP 3->48|2z7kA|5e-04|35.6|45/363| RP:PFM:NREP 1 RP:PFM:REP 27->82|PF04828|9e-07|47.3|55/92|GFA| HM:PFM:NREP 1 HM:PFM:REP 25->114|PF04828|2.2e-17|27.9|86/92|GFA| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF04828|IPR006913| GO:PFM GO:0016846|"GO:carbon-sulfur lyase activity"|PF04828|IPR006913| RP:SCP:NREP 1 RP:SCP:REP 3->121|1x6mA|5e-12|15.1|119/196|b.88.1.4| HM:SCP:REP 1->132|1x6mA_|9e-29|31.2|128/0|b.88.1.4|1/1|Mss4-like| OP:NHOMO 113 OP:NHOMOORG 103 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------11111---------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11---11111----------2---------11--1111323212-1---1--2-11112-1---------------1--------------------------------1---111------1----------------1-1-----------111--------------------------------------------------------------------------------------11------1--------1-11111---11-----1--------1----1-----------------------------------1---11111111111-1-11-------------------------1-----------11----11----------111-11--1---1-111----1111-----------------1------11---1----------------------------------------------------------------------- ---------------------------------11--------------------------------------------------------------------------------------------------------------------------------1----------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 30.8 SQ:SECSTR ##cTTccEETTcGGGTTccccccc#ccccHHHHHccHHHHHHHHHTTc################################################################################################## DISOP:02AL 144-147| PSIPRED ccEEEEEEEcccEEEEEEEcccccEEcccHHHHHcccccEEEEEEEcHHHEEEccccEEEEEccccEEEEEccccccccEEEEcccccEEEEEEEEcccccccccccccEEEEEcccccEEEEcccHHHcccccHHHHHcHHHHcc //