[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67635.1
DDBJ      :             secretion system apparatus protein SsaP
Swiss-Prot:SSAP_SALTY   RecName: Full=Secretion system apparatus protein ssaP;

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   60->82 PF08421 * Methyltransf_13 0.00052 43.5 23/78  
:BLT:SWISS 1->113 SSAP_SALTY 3e-64 99.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67635.1 GT:GENE ACF67635.1 GT:PRODUCT secretion system apparatus protein SsaP GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1502901..1503242 GB:FROM 1502901 GB:TO 1503242 GB:DIRECTION + GB:PRODUCT secretion system apparatus protein SsaP GB:PROTEIN_ID ACF67635.1 GB:DB_XREF GI:194407416 LENGTH 113 SQ:AASEQ MPCQSYQDDNEAEAERMDFEQLMHQALPIGENNPPAALNKNVVFTQRYRVSGGYLDGVECEVCESGGLIQLRINVPHHEIYRSMKALKQWLESQLLHMGYIISLEIFYVKNSE GT:EXON 1|1-113:0| SW:ID SSAP_SALTY SW:DE RecName: Full=Secretion system apparatus protein ssaP; SW:GN Name=ssaP; OrderedLocusNames=STM1417; SW:KW Complete proteome; Protein transport; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->113|SSAP_SALTY|3e-64|99.1|113/124| GO:SWS:NREP 2 GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| HM:PFM:NREP 1 HM:PFM:REP 60->82|PF08421|0.00052|43.5|23/78|Methyltransf_13| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13,112-114| PSIPRED ccccccccccHHHHHHHcHHHHHHHHcccccccccccccccEEEEEEEEEcccEEccEEEEEEccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEEEccc //