[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67657.1
DDBJ      :             acidic protein MsyB
Swiss-Prot:MSYB_ECOLI   RecName: Full=Acidic protein msyB;

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->30 PF04255 * DUF433 0.00082 38.9 18/56  
:BLT:SWISS 1->124 MSYB_ECOLI 5e-68 92.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67657.1 GT:GENE ACF67657.1 GT:PRODUCT acidic protein MsyB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1245137..1245511) GB:FROM 1245137 GB:TO 1245511 GB:DIRECTION - GB:PRODUCT acidic protein MsyB GB:PROTEIN_ID ACF67657.1 GB:DB_XREF GI:194407438 LENGTH 124 SQ:AASEQ MTMYATLEEAIDAAREEFLADHPGLEQDEANVQQFNVQKYVLQDGDIMWQVEFFADEGEDGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRTAADEWDER GT:EXON 1|1-124:0| SW:ID MSYB_ECOLI SW:DE RecName: Full=Acidic protein msyB; SW:GN Name=msyB; OrderedLocusNames=b1051, JW1039; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->124|MSYB_ECOLI|5e-68|92.7|124/100| HM:PFM:NREP 1 HM:PFM:REP 13->30|PF04255|0.00082|38.9|18/56|DUF433| OP:NHOMO 57 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1111111111111-1111111111111111111111-----1111111111-111111111---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,116-125| PSIPRED ccHHHHHHHHHHHHHHHHHHccccccHHHccHHHHccEEEEEEcccEEEEEEEEEcccccccEEEccccHHHHHHHcccHHHHHHHHHHHHHccHHHcccccEEEcccccHHHccHHHHHHccc //