[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67703.1
DDBJ      :             threonine/homoserine efflux transporter RhtA
Swiss-Prot:RHTA_SALTY   RecName: Full=Inner membrane transporter rhtA;

Homologs  Archaea  0/68 : Bacteria  218/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:295 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  184->274 1s7bA  f.39.1.1 * 1e-04 12.1 %
:HMM:SCOP  46->144 1s7bA_ f.39.1.1 * 1.5e-06 27.3 %
:HMM:SCOP  181->288 1s7bA_ f.39.1.1 * 4.5e-08 30.5 %
:HMM:PFM   30->135 PF00892 * EamA 2.1e-09 26.4 106/126  
:HMM:PFM   159->278 PF00892 * EamA 2.3e-17 24.2 120/126  
:BLT:SWISS 1->295 RHTA_SALTY e-141 95.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67703.1 GT:GENE ACF67703.1 GT:PRODUCT threonine/homoserine efflux transporter RhtA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(947728..948615) GB:FROM 947728 GB:TO 948615 GB:DIRECTION - GB:PRODUCT threonine/homoserine efflux transporter RhtA GB:NOTE identified by match to protein family HMM PF00892 GB:PROTEIN_ID ACF67703.1 GB:DB_XREF GI:194407484 LENGTH 295 SQ:AASEQ MPGSTRKLPVWLPILVLLIAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFIWVVLAVLGLWFLLPLGQDMSHVDLTGAALALGAGACWAVYILTGQRAGAEHGPATVAVGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGSTLTIRREPQIKQVDVK GT:EXON 1|1-295:0| SW:ID RHTA_SALTY SW:DE RecName: Full=Inner membrane transporter rhtA; SW:GN Name=rhtA; OrderedLocusNames=STM0832; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->295|RHTA_SALTY|e-141|95.9|295/295| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 8 TM:REGION 8->30| TM:REGION 35->57| TM:REGION 90->112| TM:REGION 119->141| TM:REGION 147->168| TM:REGION 175->197| TM:REGION 200->222| TM:REGION 252->274| SEG 8->19|lpvwlpilvlli| SEG 147->158|ltgaalalgaga| HM:PFM:NREP 2 HM:PFM:REP 30->135|PF00892|2.1e-09|26.4|106/126|EamA| HM:PFM:REP 159->278|PF00892|2.3e-17|24.2|120/126|EamA| RP:SCP:NREP 1 RP:SCP:REP 184->274|1s7bA|1e-04|12.1|91/106|f.39.1.1| HM:SCP:REP 46->144|1s7bA_|1.5e-06|27.3|99/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 181->288|1s7bA_|4.5e-08|30.5|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 247 OP:NHOMOORG 219 OP:PATTERN -------------------------------------------------------------------- -1--11112221-1----------13-----11111-223-----111-1-111-1----11111111122----1-----11------------------1-------1-------------------------------------------------------------------------111--------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1----------------1--1112------------------------------11-11111-2--2---11-111--------2-------111111111-111------------------------------------11-111-1--------------1---------1111--111--1--11----------------------1---1----------11---------------1------------------------------1-11----11------11--------1----------------1111-111111111111-111111-11111111111111111111111-1111111111-1111-1111--111111111111--1-------------1----------------3333322-----1111111111211--11--------------11111-----111---------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,282-296| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccc //