[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67707.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->27 PF08252 * Leader_CPA1 0.00061 57.1 14/24  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67707.1 GT:GENE ACF67707.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1315253..1315429) GB:FROM 1315253 GB:TO 1315429 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67707.1 GB:DB_XREF GI:194407488 LENGTH 58 SQ:AASEQ MPPVLQTYNIIRGRPSFIFTCSDAITDSNAFIREALRFYTDCQSLLKIILHPMRPQLR GT:EXON 1|1-58:0| HM:PFM:NREP 1 HM:PFM:REP 13->27|PF08252|0.00061|57.1|14/24|Leader_CPA1| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11--1-1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,57-59| PSIPRED cccHHHHHHHHcccccEEEEEcHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //