[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67711.1
DDBJ      :             3-oxoacyl-[acyl-carrier-protein] synthase 1
Swiss-Prot:FABB_ECOLI   RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 1;         EC=2.3.1.41;AltName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I;AltName: Full=Beta-ketoacyl-ACP synthase I;         Short=KAS I;

Homologs  Archaea  0/68 : Bacteria  860/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
c.95.1
:404 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->404 2vb7A PDBj 0.0 94.6 %
:RPS:PDB   1->403 2byzA PDBj 1e-97 91.1 %
:RPS:SCOP  1->253 1dd8A1  c.95.1.1 * 2e-90 90.9 %
:RPS:SCOP  253->404 1b3nA2  c.95.1.1 * 4e-28 42.1 %
:HMM:SCOP  1->253 1dd8A1 c.95.1.1 * 3.4e-62 32.8 %
:HMM:SCOP  214->404 1tqyB2 c.95.1.1 * 3.8e-60 45.5 %
:RPS:PFM   3->246 PF00109 * ketoacyl-synt 3e-12 30.4 %
:RPS:PFM   255->362 PF02801 * Ketoacyl-synt_C 4e-11 40.7 %
:HMM:PFM   2->246 PF00109 * ketoacyl-synt 2.8e-45 27.9 233/253  
:HMM:PFM   254->362 PF02801 * Ketoacyl-synt_C 9.7e-32 40.4 109/119  
:BLT:SWISS 1->404 FABB_ECOLI 0.0 94.6 %
:PROS 154->170|PS00606|B_KETOACYL_SYNTHASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67711.1 GT:GENE ACF67711.1 GT:PRODUCT 3-oxoacyl-[acyl-carrier-protein] synthase 1 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2533393..2534607) GB:FROM 2533393 GB:TO 2534607 GB:DIRECTION - GB:PRODUCT 3-oxoacyl-[acyl-carrier-protein] synthase 1 GB:NOTE identified by match to protein family HMM PF00109; match to protein family HMM PF02801 GB:PROTEIN_ID ACF67711.1 GB:DB_XREF GI:194407492 LENGTH 404 SQ:AASEQ MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTERELTTVMSNSFGFGGTNATLVMRKL GT:EXON 1|1-404:0| SW:ID FABB_ECOLI SW:DE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 1; EC=2.3.1.41;AltName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I;AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS I; SW:GN Name=fabB; Synonyms=fabC; OrderedLocusNames=b2323, JW2320; SW:KW 3D-structure; Acyltransferase; Complete proteome; Cytoplasm;Direct protein sequencing; Fatty acid biosynthesis; Lipid synthesis;Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->404|FABB_ECOLI|0.0|94.6|404/406| GO:SWS:NREP 5 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 154->170|PS00606|B_KETOACYL_SYNTHASE|PDOC00529| SEG 228->240|gfviaggggmvvv| SEG 375->384|tettereltt| BL:PDB:NREP 1 BL:PDB:REP 1->404|2vb7A|0.0|94.6|404/404| RP:PDB:NREP 1 RP:PDB:REP 1->403|2byzA|1e-97|91.1|403/405| RP:PFM:NREP 2 RP:PFM:REP 3->246|PF00109|3e-12|30.4|227/245|ketoacyl-synt| RP:PFM:REP 255->362|PF02801|4e-11|40.7|108/118|Ketoacyl-synt_C| HM:PFM:NREP 2 HM:PFM:REP 2->246|PF00109|2.8e-45|27.9|233/253|ketoacyl-synt| HM:PFM:REP 254->362|PF02801|9.7e-32|40.4|109/119|Ketoacyl-synt_C| RP:SCP:NREP 2 RP:SCP:REP 1->253|1dd8A1|2e-90|90.9|253/253|c.95.1.1| RP:SCP:REP 253->404|1b3nA2|4e-28|42.1|152/161|c.95.1.1| HM:SCP:REP 1->253|1dd8A1|3.4e-62|32.8|253/253|c.95.1.1|1/1|Thiolase-like| HM:SCP:REP 214->404|1tqyB2|3.8e-60|45.5|187/0|c.95.1.1|1/1|Thiolase-like| OP:NHOMO 3631 OP:NHOMOORG 1038 OP:PATTERN -------------------------------------------------------------------- 2261G1211111-1BBBFF-FAAAN7GFGGFCB98953462KCL1111121123211411ID21K3OVEQ2--------1112111111113111111-246542G66241111111111111111111211111122244111I3464466911111222113229CBU51111111111111111111121J111111112111111121146112111311111111183111111111111111111112-111111-1-11111111111111122211111241111111111111111111111111111111111111331111111111G1331111112--1211211311111111111111317222233333744333344533333333333333-3353443447425667446555554853253433333441111111112222213111111111111111111111111111111211112221453342EB76873345AAAA2C5641213124571233243156313222233111222212232251412512431422113435228453212VL331321111111111111111111111113432264334466666565666666556551-22221111111A2932432559277322-522222323353522222433483B742222222222222222522322222174545544545411243433366664293511113111111123111441132213944346A56352622858411111111234471222224644443333333322222212--1111--------1-1-------------------------1111111111191 1142Si3-311-11269A5GDHJGVJR222444GE56979488222HFCKB9D688IID757111111-111111211-111111111---19----------111-153J44243-2111221411215A2-1221111222411111-31141622122226513547954872334q433388459E473351223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 404 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEEEcTTcccHHHHHHHHHHTcccEEEcHHHHHTTccccEEEccccccTTcccHHHHTTccHHHHHHHHHHHHHHHHHTccHHHHTTcTTEEEEEEcccccHHHHHHHHHHHTcccTHHHHcccHHHHHcTTHHHHHHHTTTTccccEEccccGGGHHHHHHHHHHHHHHTTcccEEEEEEEEcccHHHHHHHHTTTccccccTTcGGGTccTTcTTccccccccEEEEEEEEEHHHHHHTTccccEEEEEEEEEEccccccccccHHHHHHHHHHTTTccccccEEEccccccHHHHHHHHHHHHHHHTTcccEEEcTHHHHcccGGGHHHHHHHHHHHHHHHTEEccccccccccGGGcccccccccEEccccEEEEEEEETTTEEEEEEEEcc PSIPRED cccEEEEEEEEEEcccccHHHHHHHHHccccccEEccccccccccccEEEcccccHHHcccHHHHHHccHHHHHHHHHHHHHHHHccccHHHccccccEEEEEEcccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHcccccEEEEccHHHcccHHHHHHHHcccHHHcccccccccccccccccccEEEEEEEEEEEEEcHHHHHHcccEEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEccccccEEEEEEEEEc //