[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67715.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  73/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->79 PF07351 * DUF1480 7e-38 83.5 %
:HMM:PFM   1->78 PF07351 * DUF1480 1.2e-44 67.9 78/80  
:BLT:SWISS 2->79 YEBV_SHIFL 1e-39 88.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67715.1 GT:GENE ACF67715.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1997937..1998176 GB:FROM 1997937 GB:TO 1998176 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF07351 GB:PROTEIN_ID ACF67715.1 GB:DB_XREF GI:194407496 LENGTH 79 SQ:AASEQ MMKTSVRIGAFEIDDAELHGESPGERTLTIPCKSDPDLCMQLDAWDAETSVPAILNGEHSVLFRTHYDPKSDAWVMRLA GT:EXON 1|1-79:0| BL:SWS:NREP 1 BL:SWS:REP 2->79|YEBV_SHIFL|1e-39|88.5|78/78| RP:PFM:NREP 1 RP:PFM:REP 1->79|PF07351|7e-38|83.5|79/79|DUF1480| HM:PFM:NREP 1 HM:PFM:REP 1->78|PF07351|1.2e-44|67.9|78/80|DUF1480| OP:NHOMO 73 OP:NHOMOORG 73 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-1111111-11-1111111111111111111111--11111111111111111111111111-1-111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-8,20-25| PSIPRED cccEEEEEEEEEEcccEEccccccccEEEEEccccHHHEEEEccccccccccEEEcccEEEEEEEcccccccEEEEEEc //