[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67720.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:187 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   44->186 PF10767 * DUF2593 2e-47 62.2 %
:HMM:PFM   45->187 PF10767 * DUF2593 1.5e-72 69.9 143/144  
:BLT:SWISS 30->187 YBJO_SHIFL 6e-56 74.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67720.1 GT:GENE ACF67720.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 999774..1000337 GB:FROM 999774 GB:TO 1000337 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID ACF67720.1 GB:DB_XREF GI:194407501 LENGTH 187 SQ:AASEQ MQDAAEATKIFHYGNALPRGSRHHFQGRHSLGFIKQSTSSHARLNVPTLVQVAAMAIILIRGLDVLMIMNTLGIRGMGEFIHRSVQTWSLTLVFLASLVLVFVEIYCAFSLVKGRSWARWVYLATQIIVSGYLWAASLGYGYPELFSIAGESKRDILHSLVMQKLPDLLILFLLFIPAPSRRFFRLQ GT:EXON 1|1-187:0| BL:SWS:NREP 1 BL:SWS:REP 30->187|YBJO_SHIFL|6e-56|74.1|158/162| TM:NTM 3 TM:REGION 47->69| TM:REGION 89->111| TM:REGION 118->140| SEG 89->103|sltlvflaslvlvfv| SEG 165->177|lpdllilfllfip| RP:PFM:NREP 1 RP:PFM:REP 44->186|PF10767|2e-47|62.2|143/143|DUF2593| HM:PFM:NREP 1 HM:PFM:REP 45->187|PF10767|1.5e-72|69.9|143/144|DUF2593| OP:NHOMO 74 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111111111111-1111111111111-1111111111---111111111111111111111111---11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHccccccccccccccccHHEEHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHEEEcccccHHHHHHHHHHHHccHHHHHHHHHccccccHHHHcc //