[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67764.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YEDF_SHIFL   RecName: Full=UPF0033 protein yedF;

Homologs  Archaea  1/68 : Bacteria  101/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.3
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->77 1je3A PDBj 5e-43 100.0 %
:RPS:PDB   1->77 1dcjA PDBj 6e-19 28.6 %
:RPS:SCOP  3->77 1pavA  d.68.3.3 * 4e-19 22.7 %
:HMM:SCOP  1->77 1je3A_ d.68.3.3 * 2.8e-25 37.7 %
:RPS:PFM   10->77 PF01206 * SirA 8e-11 41.2 %
:HMM:PFM   9->77 PF01206 * SirA 6e-23 33.3 69/70  
:BLT:SWISS 1->77 YEDF_SHIFL 2e-42 100.0 %
:PROS 10->34|PS01148|UPF0033

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67764.1 GT:GENE ACF67764.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2102623..2102856 GB:FROM 2102623 GB:TO 2102856 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01206 GB:PROTEIN_ID ACF67764.1 GB:DB_XREF GI:194407545 LENGTH 77 SQ:AASEQ MKNIVPDYRLDMVGEPCPYPAVATLEAMPQLKKGEILEVVSDCPQSINNIPLDARNHGYTVLDIQQDGPTIRYLIQK GT:EXON 1|1-77:0| SW:ID YEDF_SHIFL SW:DE RecName: Full=UPF0033 protein yedF; SW:GN Name=yedF; OrderedLocusNames=SF1973, S2069; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->77|YEDF_SHIFL|2e-42|100.0|77/77| PROS 10->34|PS01148|UPF0033|PDOC00884| BL:PDB:NREP 1 BL:PDB:REP 1->77|1je3A|5e-43|100.0|77/97| RP:PDB:NREP 1 RP:PDB:REP 1->77|1dcjA|6e-19|28.6|77/81| RP:PFM:NREP 1 RP:PFM:REP 10->77|PF01206|8e-11|41.2|68/70|SirA| HM:PFM:NREP 1 HM:PFM:REP 9->77|PF01206|6e-23|33.3|69/70|SirA| GO:PFM:NREP 4 GO:PFM GO:0005515|"GO:protein binding"|PF01206|IPR001455| GO:PFM GO:0005737|"GO:cytoplasm"|PF01206|IPR001455| GO:PFM GO:0008033|"GO:tRNA processing"|PF01206|IPR001455| GO:PFM GO:0016783|"GO:sulfurtransferase activity"|PF01206|IPR001455| RP:SCP:NREP 1 RP:SCP:REP 3->77|1pavA|4e-19|22.7|75/78|d.68.3.3| HM:SCP:REP 1->77|1je3A_|2.8e-25|37.7|77/97|d.68.3.3|1/1|SirA-like| OP:NHOMO 102 OP:NHOMOORG 102 OP:PATTERN -------------------1------------------------------------------------ -----------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------1--1-111111-1-------1-------------------111--1111--11-----------------11---1-1111111-11-1111111111111-11--1111----1111111111111111111111111--111111111111------------------111------------------------1111-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 100.0 SQ:SECSTR cccccccEEEccTTccTTHHHHHHHHHHHHccTTccEEEEEccTTHHHHHHHHHHHTTcEEEEEEcccccEEEEEEc DISOP:02AL 1-2| PSIPRED cccccccEEEEEccccccHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEc //