[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67800.1
DDBJ      :             probable secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->261 PF11453 * DUF2950 1e-71 62.0 %
:HMM:PFM   20->261 PF11453 * DUF2950 3e-96 52.5 242/271  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67800.1 GT:GENE ACF67800.1 GT:PRODUCT probable secreted protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(178242..179033) GB:FROM 178242 GB:TO 179033 GB:DIRECTION - GB:PRODUCT probable secreted protein GB:PROTEIN_ID ACF67800.1 GB:DB_XREF GI:194407581 LENGTH 263 SQ:AASEQ MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQLTALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPMVKETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISSEGQKDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHYGETGVMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE GT:EXON 1|1-263:0| SEG 6->16|lsalllslpll| SEG 28->38|aaasafaaava| RP:PFM:NREP 1 RP:PFM:REP 20->261|PF11453|1e-71|62.0|242/270|DUF2950| HM:PFM:NREP 1 HM:PFM:REP 20->261|PF11453|3e-96|52.5|242/271|DUF2950| OP:NHOMO 71 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- -22------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------------------------------------1111121-------------------------------------------------------------------111--------------23--------22223-----------------11-----------------------------------1--112-1-------2----------------------------------------------------------------------11---1-------------------------------111-----1111111111111111-------------------------------------------------------------------------1--1111----------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,258-258,261-264| PSIPRED cHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEcccEEEEEEcccccccccHHEEcccccEEEHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHccccccccccEEEEEEcccccccEEEEEEHHHHcccccEEEEEcccccEEHHHccccHHHHHHHHHccccccccEEcc //