[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67809.1
DDBJ      :             membrane protein, GPR1/FUN34/yaaH family
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  187/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->184 PF01184 * Grp1_Fun34_YaaH 4e-34 55.3 %
:HMM:PFM   4->183 PF01184 * Grp1_Fun34_YaaH 9e-63 42.5 179/211  
:BLT:SWISS 1->188 YAAH_SHIFL 2e-91 84.6 %
:PROS 8->17|PS01114|GPR1_FUN34_YAAH
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67809.1 GT:GENE ACF67809.1 GT:PRODUCT membrane protein, GPR1/FUN34/yaaH family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(9375..9941) GB:FROM 9375 GB:TO 9941 GB:DIRECTION - GB:PRODUCT membrane protein, GPR1/FUN34/yaaH family GB:NOTE identified by match to protein family HMM PF01184 GB:PROTEIN_ID ACF67809.1 GB:DB_XREF GI:194407590 LENGTH 188 SQ:AASEQ MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFYGGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLGLWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEAIIHIAGWVGLVCGASAIYLAMGEVLNEQFGRTILPIGEAH GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 1->188|YAAH_SHIFL|2e-91|84.6|188/188| PROS 8->17|PS01114|GPR1_FUN34_YAAH|PDOC00890| TM:NTM 6 TM:REGION 8->30| TM:REGION 36->57| TM:REGION 74->94| TM:REGION 97->119| TM:REGION 122->144| TM:REGION 151->173| RP:PFM:NREP 1 RP:PFM:REP 5->184|PF01184|4e-34|55.3|179/198|Grp1_Fun34_YaaH| HM:PFM:NREP 1 HM:PFM:REP 4->183|PF01184|9e-63|42.5|179/211|Grp1_Fun34_YaaH| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01184|IPR000791| OP:NHOMO 487 OP:NHOMOORG 319 OP:PATTERN ------1111111111-1----------------1---1111123--112323--------111---- ---12-----------------------------------1---------------------------------------1-----------------------------------------------------1------1-------------------------------------------------1--11111111-111111----1-111--------------------------------------------------------------------------------------------------------------------------------1-------2---1-11-----------------------------------1---------------------------------------------------111111111------------------------------------------------------------1---------1----------------------1----1-------------1-1--1-11-11111-111-1--1111-1--1----------------------------111-------111111-1111111111111-------------111111-1111111111-11111111111111111111111111-111111111111111111111111--111111111111------------------111--------1111---------------------------------------11111111111111-----------------1----------------1-------------------------------------- --------64----122222111222312121222222121221222125324211111111636241-6333374323336887711-12123223121113354--1------------------------------------------------------------------154--111423---1---1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,188-189| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHcccccccEEEEccccc //