[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67813.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67813.1 GT:GENE ACF67813.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2014104..2014271 GB:FROM 2014104 GB:TO 2014271 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACF67813.1 GB:DB_XREF GI:194407594 LENGTH 55 SQ:AASEQ MKNIITIIVAIIIVFYAGMWSQKFLMEDECLDSGGSFNENGICNIAGSHQDVPPK GT:EXON 1|1-55:0| TM:NTM 1 TM:REGION 1->22| SEG 4->14|iitiivaiiiv| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11111---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,50-56| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccc //