[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67836.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:EFPL_SALTY   RecName: Full=Elongation factor P-like protein;

Homologs  Archaea  0/68 : Bacteria  899/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
b.34.5b.40.4
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->189 1uebA PDBj 2e-22 31.9 %
:RPS:PDB   3->129 3cpfA PDBj 2e-24 12.3 %
:RPS:SCOP  1->65 1uebA1  b.34.5.2 * 1e-14 20.6 %
:RPS:SCOP  67->130 1bkbA2  b.40.4.5 * 8e-13 15.9 %
:RPS:SCOP  133->189 1uebA3  b.40.4.5 * 8e-14 45.6 %
:HMM:SCOP  1->65 1uebA1 b.34.5.2 * 3.9e-12 28.6 %
:HMM:SCOP  66->131 1uebA2 b.40.4.5 * 1.6e-13 34.9 %
:HMM:SCOP  132->189 1uebA3 b.40.4.5 * 5.8e-17 50.0 %
:RPS:PFM   69->123 PF01132 * EFP 5e-06 43.4 %
:RPS:PFM   133->188 PF09285 * Elong-fact-P_C 1e-11 50.0 %
:HMM:PFM   133->188 PF09285 * Elong-fact-P_C 1.2e-24 50.0 56/56  
:HMM:PFM   70->124 PF01132 * EFP 2.7e-17 32.1 53/55  
:HMM:PFM   4->61 PF08207 * EFP_N 4.1e-16 21.4 56/58  
:BLT:SWISS 1->190 EFPL_SALTY e-107 100.0 %
:PROS 154->173|PS01275|EFP

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67836.1 GT:GENE ACF67836.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2358311..2358883 GB:FROM 2358311 GB:TO 2358883 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01132; match to protein family HMM PF08207; match to protein family HMM PF09285; match to protein family HMM TIGR02178 GB:PROTEIN_ID ACF67836.1 GB:DB_XREF GI:194407617 LENGTH 190 SQ:AASEQ MPRANEIKKGMVLNYNGKLLIVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGVDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTWDGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGLVIQVPEYLSAGEKIRIHIEERRYMGRAD GT:EXON 1|1-190:0| SW:ID EFPL_SALTY SW:DE RecName: Full=Elongation factor P-like protein; SW:GN Name=yeiP; OrderedLocusNames=STM2211; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->190|EFPL_SALTY|e-107|100.0|190/190| PROS 154->173|PS01275|EFP|PDOC00981| BL:PDB:NREP 1 BL:PDB:REP 1->189|1uebA|2e-22|31.9|182/184| RP:PDB:NREP 1 RP:PDB:REP 3->129|3cpfA|2e-24|12.3|122/132| RP:PFM:NREP 2 RP:PFM:REP 69->123|PF01132|5e-06|43.4|53/55|EFP| RP:PFM:REP 133->188|PF09285|1e-11|50.0|56/56|Elong-fact-P_C| HM:PFM:NREP 3 HM:PFM:REP 133->188|PF09285|1.2e-24|50.0|56/56|Elong-fact-P_C| HM:PFM:REP 70->124|PF01132|2.7e-17|32.1|53/55|EFP| HM:PFM:REP 4->61|PF08207|4.1e-16|21.4|56/58|EFP_N| GO:PFM:NREP 2 GO:PFM GO:0003746|"GO:translation elongation factor activity"|PF01132|IPR001059| GO:PFM GO:0006414|"GO:translational elongation"|PF01132|IPR001059| RP:SCP:NREP 3 RP:SCP:REP 1->65|1uebA1|1e-14|20.6|63/63|b.34.5.2| RP:SCP:REP 67->130|1bkbA2|8e-13|15.9|63/65|b.40.4.5| RP:SCP:REP 133->189|1uebA3|8e-14|45.6|57/58|b.40.4.5| HM:SCP:REP 1->65|1uebA1|3.9e-12|28.6|63/0|b.34.5.2|1/1|Translation proteins SH3-like domain| HM:SCP:REP 66->131|1uebA2|1.6e-13|34.9|63/63|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 132->189|1uebA3|5.8e-17|50.0|58/58|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1114 OP:NHOMOORG 927 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111221--1111111211111111112221111211111111111111112221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121222212221111222221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111221111111111111111111111-11111111121111111111111111111112222211111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111-11111111111111111111112111111111111222222222111111111111111111111111111111111111112222122212111111111111111211-11111-1----22222222222222222-2222222222222221222222222222222222221212222222222221-2222222122221112111111111122121111111111111111111111111111111111111111111111111111122222222222222222222222222222111111111-1111111111111111-11111111111111111111111111111111 ------------111----------------------------------------------------------------------------------------11---2------------------------------------------------------------------1211F-11122221-221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 99.5 SQ:SECSTR EEEGGGccTTcEEEETTEEEEEEEEEEEccccEcEcEEEEEEEEETTTccEEEEEEETTcEEEEEccEEEEEEEEEEETTEEEEEcTTccEEcccccHHHHHHHHHHHHHTcccEEEEEETTEEEEEEEEcEEEEEEEEcccccccccccccEEEEEETTccEEEEETTccTTcEEEEETTTTEEEEEc# DISOP:02AL 1-1,190-191| PSIPRED cccccccccccEEEEccEEEEEEEEEEEcccccccEEEEEEEEEEcccccEEEEEEccccEEEEEEEEEEEEEEEEEcccEEEEEEcccccEEEEcHHHHHHHHHHcccccEEEEEEEEEccEEEEEEcccEEEEEEEEcccccccEEccccccEEEEEcccEEEcccccccccEEEEEcccccEEEEcc //