[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67853.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:HMM:PFM   2->28 PF10080 * DUF2318 0.001 25.9 27/102  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67853.1 GT:GENE ACF67853.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1923686..1923814) GB:FROM 1923686 GB:TO 1923814 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF67853.1 GB:DB_XREF GI:194407634 LENGTH 42 SQ:AASEQ MIWCNNCLMALRLSGLKTEPAGCKNVRAAIRQIFAIGYSYSL GT:EXON 1|1-42:0| HM:PFM:NREP 1 HM:PFM:REP 2->28|PF10080|0.001|25.9|27/102|DUF2318| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHHcccc //