[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67857.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:40 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->32 PF04241 * DUF423 0.00024 36.0 25/89  
:BLT:SWISS 10->40 YNEM_ECOLI 1e-11 80.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67857.1 GT:GENE ACF67857.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1641209..1641331) GB:FROM 1641209 GB:TO 1641331 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67857.1 GB:DB_XREF GI:194407638 LENGTH 40 SQ:AASEQ MHTKIRRNEMLGSINLFIVVLGIILFSGFLAAWFSHKWDD GT:EXON 1|1-40:0| BL:SWS:NREP 1 BL:SWS:REP 10->40|YNEM_ECOLI|1e-11|80.6|31/100| TM:NTM 1 TM:REGION 12->34| HM:PFM:NREP 1 HM:PFM:REP 8->32|PF04241|0.00024|36.0|25/89|DUF423| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------11------1--------11-----------1--111-111----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,40-41| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //