[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67868.1
DDBJ      :             tetratricopeptide TPR_2 repeat protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  313/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   159->254 1na0A PDBj 6e-06 31.1 %
:RPS:PDB   137->247 2cg3A PDBj 1e-09 11.5 %
:RPS:SCOP  145->247 1w3bA  a.118.8.1 * 8e-07 17.5 %
:HMM:SCOP  135->263 2fbnA1 a.118.8.1 * 7.5e-11 20.2 %
:HMM:PFM   180->211 PF07719 * TPR_2 3.4e-05 28.1 32/34  
:HMM:PFM   216->248 PF07719 * TPR_2 9.4e-05 24.2 33/34  
:HMM:PFM   35->81 PF08702 * Fib_alpha 0.00011 29.8 47/146  
:BLT:SWISS 1->262 YBGF_ECOLI 8e-96 85.5 %
:TM
:COIL
:REPEAT 2|157->193|194->230
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67868.1 GT:GENE ACF67868.1 GT:PRODUCT tetratricopeptide TPR_2 repeat protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 866064..866852 GB:FROM 866064 GB:TO 866852 GB:DIRECTION + GB:PRODUCT tetratricopeptide TPR_2 repeat protein GB:NOTE identified by match to protein family HMM PF07719; match to protein family HMM TIGR02795 GB:PROTEIN_ID ACF67868.1 GB:DB_XREF GI:194407649 LENGTH 262 SQ:AASEQ MSSNFRHHLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQLERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVMERQKQIMLQLGSLNNGGAAQPAAGDQSGAATTATPAPDAGTATSGAPVQSGDANTDYNAAIALVQDKSRQDDAIVAFQNFIKKYPDSTYQPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMYKVGVIMQDKGDTAKAKAVYQQVINKYPGTDGAKQAQKRLNAM GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 1->262|YBGF_ECOLI|8e-96|85.5|262/263| COIL:NAA 40 COIL:NSEG 1 COIL:REGION 50->89| TM:NTM 1 TM:REGION 9->31| NREPEAT 1 REPEAT 2|157->193|194->230| SEG 19->28|aapwaafaqa| SEG 53->73|sqlltqlqqqlsdnqsdidsl| SEG 116->135|gaattatpapdagtatsgap| BL:PDB:NREP 1 BL:PDB:REP 159->254|1na0A|6e-06|31.1|90/119| RP:PDB:NREP 1 RP:PDB:REP 137->247|2cg3A|1e-09|11.5|104/617| HM:PFM:NREP 3 HM:PFM:REP 180->211|PF07719|3.4e-05|28.1|32/34|TPR_2| HM:PFM:REP 216->248|PF07719|9.4e-05|24.2|33/34|TPR_2| HM:PFM:REP 35->81|PF08702|0.00011|29.8|47/146|Fib_alpha| RP:SCP:NREP 1 RP:SCP:REP 145->247|1w3bA|8e-07|17.5|97/388|a.118.8.1| HM:SCP:REP 135->263|2fbnA1|7.5e-11|20.2|124/0|a.118.8.1|1/1|TPR-like| OP:NHOMO 329 OP:NHOMOORG 313 OP:PATTERN -------------------------------------------------------------------- -11--------------------------------------------------------------------------------1--11--1------------------1---------------11-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1---------11111111111-11-11111--1-11111-11111---1-------------------------111------------------------------------111-111111111111111111111111122111111111--1--1-11111--1---------111111-221--112212212121212221--2---11-------------------------11111-111111111111111111111111111--11-1------11111111112111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111---------------111111----1111111111111111111---------11111111111111111111111111111--11------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 48.1 SQ:SECSTR ########################################################################################################################################HHTcHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHcTTcHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHH DISOP:02AL 1-4,27-42,99-138| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHcc //