[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67888.1
DDBJ      :             membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  91/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->142 PF06610 * DUF1144 2e-57 78.2 %
:HMM:PFM   3->142 PF06610 * DUF1144 1.1e-72 70.0 140/143  
:BLT:SWISS 1->149 YGAW_SHIFL 2e-66 79.9 %
:TM
:REPEAT 2|12->74|82->143
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67888.1 GT:GENE ACF67888.1 GT:PRODUCT membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2922836..2923285 GB:FROM 2922836 GB:TO 2923285 GB:DIRECTION + GB:PRODUCT membrane protein GB:NOTE identified by match to protein family HMM PF06610 GB:PROTEIN_ID ACF67888.1 GB:DB_XREF GI:194407669 LENGTH 149 SQ:AASEQ MFSPQSRLRHAVADTFAMVVYCSVVNMLIEIFLSGMSFEQSLSSRLVAIPVNILIAWPYGVYRDLIMRVARKASPAGWAKNLADVLAYVTFQSPVYIIILLTVGAGWHQIVAAVSSNIVVSMLMGAVYGYFLDYCRRLFKVSSYHQAKA GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 1->149|YGAW_SHIFL|2e-66|79.9|149/149| TM:NTM 4 TM:REGION 13->35| TM:REGION 41->63| TM:REGION 83->105| TM:REGION 111->133| NREPEAT 1 REPEAT 2|12->74|82->143| SEG 110->121|ivaavssnivvs| RP:PFM:NREP 1 RP:PFM:REP 1->142|PF06610|2e-57|78.2|142/142|DUF1144| HM:PFM:NREP 1 HM:PFM:REP 3->142|PF06610|1.1e-72|70.0|140/143|DUF1144| OP:NHOMO 91 OP:NHOMOORG 91 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1-1111111111-111111111111111111111111---1111111111111111111111111-111111111111------------------------------------------------------------------------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,146-150| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //