[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67893.1
DDBJ      :             substrate-binding region of ABC-type glycine betaine transport system
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  418/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->300 1sw4A PDBj 7e-32 32.8 %
:RPS:PDB   25->254 2b65A PDBj 7e-08 12.0 %
:RPS:SCOP  26->300 1sw1A  c.94.1.1 * 3e-79 30.0 %
:HMM:SCOP  24->301 1sw5A_ c.94.1.1 * 8e-59 34.6 %
:RPS:PFM   26->295 PF04069 * OpuAC 2e-28 38.4 %
:HMM:PFM   25->295 PF04069 * OpuAC 1.7e-69 37.3 241/257  
:BLT:SWISS 28->295 OPUCC_BACSU 2e-33 34.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67893.1 GT:GENE ACF67893.1 GT:PRODUCT substrate-binding region of ABC-type glycine betaine transport system GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1617468..1618370) GB:FROM 1617468 GB:TO 1618370 GB:DIRECTION - GB:PRODUCT substrate-binding region of ABC-type glycine betaine transport system GB:NOTE identified by match to protein family HMM PF04069 GB:PROTEIN_ID ACF67893.1 GB:DB_XREF GI:194407674 LENGTH 300 SQ:AASEQ MRFKKHLLGWLAATLLFSSQTQAAPLVLATKSFTEQHILSAMTVQYLQKKGFQVQPQTNIAAVISRNAMVNKQIDITWEYTGTSLIIFNRIDKRMSPQETYDTVKRLDAKLGLVWLKPADMNNTYAFAMQRKRAESENITTISQMVAKIEQVRQNDPDHNWMLGLDLEFAGRSDGMKPLQQAYQMQLDRPQIRQMDPGLVYNAVRDGLVDAGLVYTTDGRVKGFDLKVLEDDKGFFPSYAVTPVVRKEVLEANPGLDDALNTLSGLLNNDVISTLNAQVDIEHRTPQQVAHQFLQDKGLL GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 28->295|OPUCC_BACSU|2e-33|34.9|252/303| BL:PDB:NREP 1 BL:PDB:REP 26->300|1sw4A|7e-32|32.8|259/270| RP:PDB:NREP 1 RP:PDB:REP 25->254|2b65A|7e-08|12.0|208/341| RP:PFM:NREP 1 RP:PFM:REP 26->295|PF04069|2e-28|38.4|242/256|OpuAC| HM:PFM:NREP 1 HM:PFM:REP 25->295|PF04069|1.7e-69|37.3|241/257|OpuAC| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF04069|IPR007210| GO:PFM GO:0005488|"GO:binding"|PF04069|IPR007210| GO:PFM GO:0006810|"GO:transport"|PF04069|IPR007210| RP:SCP:NREP 1 RP:SCP:REP 26->300|1sw1A|3e-79|30.0|263/271|c.94.1.1| HM:SCP:REP 24->301|1sw5A_|8e-59|34.6|266/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 544 OP:NHOMOORG 425 OP:PATTERN -----------------------1--------1-----------1----1--1-------2------- 1-1-1-11----1-211----2--21-----112222233-1-11--1111-2-1-11--111-211422----------1-2----------------------1-11------------------------------11---1-111111111-----------1111-------------111-------211111111-1111112-11221111111121222222-1222222222222222233232-2122111-122112221211-11122211-112211111111111111111111111111111-1111---2211111111111211111111---1----11----11-11----11---1--1------111111-1-11111111111111-1111111111--311111121122----1--1----------------------1------------------------------1-1-------1222212111111--1111112112222--111-------2112-------2----------------1--1------------------1-1111-------------1-1111111----------------------------------------1---------32---2-1111111111-1111111111111111112121-----222222222222222211-11111--1-1-122-1111----11111------14-----1----------------------1111111111111-111--------------------------11111111----------------------------------------------------2---------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 91.7 SQ:SECSTR ########################cEEEEEEHHHHHHHHHHHHHHHHHHTTTcEEEEEEccHHHHHHHHHHTcccEEEEcHHHHHHHHHcEEEEEEEEcccccTTccGGH#ccEEEEEEEGcccccEEEEEEEETTcTTccGGGcTTcEEEEccTTcTTTTHHHHHHHHHHHTccHHHHHccGGGcccEEEcTTccTTcGGGTTccccTTcccTccTTcTTcHHHHHHHHTTcccEEEEEHEHHHHHTcTTcccHHHHHHHTcTTcccHHHHHHHHHHHHTccccHHHHHHHHHHHTTcc DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccEEEEEcHHHHHHHccccccccHHHHHHHHHHHHHHccEEEEccccccccEEEEEcHHHHHHcccccHHHHHHHHHHccccccccccEEcccHHHcccHHHHHHHHHHHcccccccccEEccHHHHHHHHHccccEEEEEEcccccHHHcccEEEEccccccccccEEEEEEHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccc //