[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67911.1
DDBJ      :             protein ThiJ
Swiss-Prot:THIJ_SALTY   RecName: Full=Protein thiJ;

Homologs  Archaea  1/68 : Bacteria  221/915 : Eukaryota  102/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->196 2ab0A PDBj 4e-99 90.8 %
:RPS:PDB   2->196 2ab0A PDBj 5e-29 90.8 %
:RPS:SCOP  4->172 1g2iA  c.23.16.2 * 5e-27 24.1 %
:HMM:SCOP  2->187 2ab0A1 c.23.16.2 * 3.3e-50 38.8 %
:RPS:PFM   38->170 PF01965 * DJ-1_PfpI 2e-07 32.3 %
:HMM:PFM   32->172 PF01965 * DJ-1_PfpI 6.5e-36 39.9 138/148  
:BLT:SWISS 1->196 THIJ_SALTY e-104 99.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67911.1 GT:GENE ACF67911.1 GT:PRODUCT protein ThiJ GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(533362..533952) GB:FROM 533362 GB:TO 533952 GB:DIRECTION - GB:PRODUCT protein ThiJ GB:NOTE identified by match to protein family HMM PF01965; match to protein family HMM TIGR01383 GB:PROTEIN_ID ACF67911.1 GB:DB_XREF GI:194407692 LENGTH 196 SQ:AASEQ MSAQALVCLAPGSEETEAVTTIDLLVRGGIHVTTASVASDGNLTIVCSRGVKLLADAPLVEVADGDYDIIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIVAAICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLAGREKAHEVASQLVMAAGIYNYYE GT:EXON 1|1-196:0| SW:ID THIJ_SALTY SW:DE RecName: Full=Protein thiJ; SW:GN Name=thiJ; OrderedLocusNames=STM0433; SW:KW Complete proteome; Oxidation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->196|THIJ_SALTY|e-104|99.5|196/196| SEG 103->110|aaicaaaa| BL:PDB:NREP 1 BL:PDB:REP 2->196|2ab0A|4e-99|90.8|195/195| RP:PDB:NREP 1 RP:PDB:REP 2->196|2ab0A|5e-29|90.8|195/195| RP:PFM:NREP 1 RP:PFM:REP 38->170|PF01965|2e-07|32.3|130/135|DJ-1_PfpI| HM:PFM:NREP 1 HM:PFM:REP 32->172|PF01965|6.5e-36|39.9|138/148|DJ-1_PfpI| RP:SCP:NREP 1 RP:SCP:REP 4->172|1g2iA|5e-27|24.1|162/166|c.23.16.2| HM:SCP:REP 2->187|2ab0A1|3.3e-50|38.8|183/0|c.23.16.2|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 423 OP:NHOMOORG 324 OP:PATTERN ------------------------------------------------1------------------- ---------------------------------------------------------------1--------------------1-1111-11211---------------------------------------------111----------------1-----1--------------------------------------------11-----------------------------------------1-1--1------11------------------1--11111111111-------------111111111----111111111111--11-11111-1---1--------1--------11-------------------------------------11-11-1---------------------------------------------------------------------------------------------------------------------------------------1--1-----------------1--------------------1-----1--11111-------1-------11-1111111--1--------------------------11111------21221211111111111-1111111111111111111111221-22222222222222222111111111-122222222222-----------------1--------------------------------11-1----1------------111221111111-11----------------1111111111111111---111-----1--------------------------111 1111----3111111--11-------------------------------------------------------------------11--1--11--------111--11111111311-111-62-1-441-1131-113-111111--111111211221111112115221-111181111123621411163431 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEcTTccHHHHHHHHHHHHHTTcEEEEEEcccTTccEEEcTTccEEEccEEHHHHTTccccEEEEcccHHHHHHHHHcHHHHHHHHHHHHTTcEEEEETHHHHHHTTTTTccccccccccGGGGGGccTTTcccccEEEETTTTEEEEccGGGHHHHHHHHHHHHTcHHHHHHHHTTTTccTTcccccc DISOP:02AL 1-1,194-197| PSIPRED cccEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEEccccccEEEEcccEEEEEcccHHHccHHHccEEEEccccccHHHHHccHHHHHHHHHHHHcccEEEEEEccHHHHHHHcccccccEEEEcccHHHHccccEEEcccEEEEccccEEEcccHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHccccc //