[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67912.1
DDBJ      :             YbaK/prolyl-tRNA synthetase-associated domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  85/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   16->168 1dbuA PDBj 7e-20 16.9 %
:RPS:SCOP  15->164 1wdvA  d.116.1.1 * 1e-17 18.6 %
:HMM:SCOP  11->166 1vjfA_ d.116.1.1 * 1.8e-33 35.5 %
:HMM:PFM   33->157 PF04073 * YbaK 1.7e-26 26.4 121/123  
:BLT:SWISS 4->168 YEAK_ECOLI 2e-69 87.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67912.1 GT:GENE ACF67912.1 GT:PRODUCT YbaK/prolyl-tRNA synthetase-associated domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1362763..1363290) GB:FROM 1362763 GB:TO 1363290 GB:DIRECTION - GB:PRODUCT YbaK/prolyl-tRNA synthetase-associated domain protein GB:NOTE identified by match to protein family HMM PF04073 GB:PROTEIN_ID ACF67912.1 GB:DB_XREF GI:194407693 LENGTH 175 SQ:AASEQ MAEMTEVAKGVATHQRLVALLTQENARYRVVNHEAVGKCEAVSEIRGTALGQGAKALVCKVKGNGVNQHVLAILAADQQADLSQLASHLGGLRASLASPAEVDMLTGCVFGAIPPFSFHPNLKLVADPLLFERFDEIAFNAGLLEKSVIMNTQDYLRIARPELAVFRRFQSSPTA GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 4->168|YEAK_ECOLI|2e-69|87.9|165/167| SEG 71->87|lailaadqqadlsqlas| RP:PDB:NREP 1 RP:PDB:REP 16->168|1dbuA|7e-20|16.9|148/150| HM:PFM:NREP 1 HM:PFM:REP 33->157|PF04073|1.7e-26|26.4|121/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 15->164|1wdvA|1e-17|18.6|145/150|d.116.1.1| HM:SCP:REP 11->166|1vjfA_|1.8e-33|35.5|152/168|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 87 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------1--------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111111---------------11---------------1------------1-----------------------------------------------11-------------------------------------------------------------------11--1111111111111-1111111111111111111111--1111111111111111111-11111-1--------------------------------111111--------------------------1------------------------------------------------------------------------------------------------------------ ------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 88.6 SQ:SECSTR ###########HHHHHHHHHHHHHTcccEEEEccccccccHHHHHHTccGGGEEEEEEEEETTcTT#cTcEEEEEEETTcccHHHHHHHHTcccEEEcHHHHHHHHcccTTccccccccccccEEEEGGGGG#cccEEEEcccTTEEEEEcHHHHHHHHTcEEEcccc####### DISOP:02AL 1-14,171-176| PSIPRED ccHHHHcccccHHHHHHHHHHHHccccEEEEEccccccHHHHHHHccccHHHEEEEEEEEEccccccEEEEEEEEcccEEcHHHHHHHHcccccEEccHHHHHHHccccccccccccccccccEEEEHHHHcccccEEEcccccccEEEEcHHHHHHHHccEEEEEEcccccccc //