[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67929.1
DDBJ      :             conserved domain protein
Swiss-Prot:NINH_BPP22   RecName: Full=Protein ninH;

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  13/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->63 PF06322 * Phage_NinH 2e-21 79.4 %
:HMM:PFM   1->64 PF06322 * Phage_NinH 3.7e-43 68.8 64/64  
:BLT:SWISS 1->67 NINH_BPP22 5e-37 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67929.1 GT:GENE ACF67929.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 391696..391899 GB:FROM 391696 GB:TO 391899 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF06322 GB:PROTEIN_ID ACF67929.1 GB:DB_XREF GI:194407710 LENGTH 67 SQ:AASEQ MTHTVKTIPDMLIETYGNQTEVARRLSCHRNTVRRYLYDKEARYHAIVNGVLMIHQGGRGIYDRNQH GT:EXON 1|1-67:0| SW:ID NINH_BPP22 SW:DE RecName: Full=Protein ninH; SW:GN Name=ninH; SW:KW SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->67|NINH_BPP22|5e-37|100.0|67/67| RP:PFM:NREP 1 RP:PFM:REP 1->63|PF06322|2e-21|79.4|63/64|Phage_NinH| HM:PFM:NREP 1 HM:PFM:REP 1->64|PF06322|3.7e-43|68.8|64/64|Phage_NinH| OP:NHOMO 29 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---1---111-----1----1---1--1-----------1----1-1---1------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------11------1------1------------------------------------1---------------------------------------1-11---11--------111------------------ DISOP:02AL 1-2,61-68| PSIPRED ccEEEEEHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEccccccccccc //