[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67938.1
DDBJ      :             lysine-arginine-ornithine-binding periplasmic protein
Swiss-Prot:ARGT_SALTY   RecName: Full=Lysine-arginine-ornithine-binding periplasmic protein;         Short=LAO-binding protein;Flags: Precursor;

Homologs  Archaea  29/68 : Bacteria  669/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->260 1lstA PDBj e-137 100.0 %
:RPS:PDB   26->257 3delB PDBj 3e-44 26.7 %
:RPS:SCOP  23->260 1hslA  c.94.1.1 * 5e-52 70.2 %
:HMM:SCOP  1->258 2a5sA1 c.94.1.1 * 7.5e-66 38.7 %
:RPS:PFM   30->254 PF00497 * SBP_bac_3 1e-32 38.0 %
:HMM:PFM   28->254 PF00497 * SBP_bac_3 2.8e-67 36.4 220/225  
:BLT:SWISS 1->260 ARGT_SALTY e-148 100.0 %
:PROS 50->63|PS01039|SBP_BACTERIAL_3
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67938.1 GT:GENE ACF67938.1 GT:PRODUCT lysine-arginine-ornithine-binding periplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2510281..2511063) GB:FROM 2510281 GB:TO 2511063 GB:DIRECTION - GB:PRODUCT lysine-arginine-ornithine-binding periplasmic protein GB:NOTE identified by match to protein family HMM PF00497; match to protein family HMM TIGR01096 GB:PROTEIN_ID ACF67938.1 GB:DB_XREF GI:194407719 LENGTH 260 SQ:AASEQ MKKTVLALSLLIGLGATAASYAALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD GT:EXON 1|1-260:0| SW:ID ARGT_SALTY SW:DE RecName: Full=Lysine-arginine-ornithine-binding periplasmic protein; Short=LAO-binding protein;Flags: Precursor; SW:GN Name=argT; OrderedLocusNames=STM2355; SW:KW 3D-structure; Amino-acid transport; Complete proteome; Disulfide bond;Periplasm; Signal; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->260|ARGT_SALTY|e-148|100.0|260/260| GO:SWS:NREP 3 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 50->63|PS01039|SBP_BACTERIAL_3|PDOC00798| TM:NTM 1 TM:REGION 4->26| BL:PDB:NREP 1 BL:PDB:REP 23->260|1lstA|e-137|100.0|238/238| RP:PDB:NREP 1 RP:PDB:REP 26->257|3delB|3e-44|26.7|225/232| RP:PFM:NREP 1 RP:PFM:REP 30->254|PF00497|1e-32|38.0|216/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 28->254|PF00497|2.8e-67|36.4|220/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 23->260|1hslA|5e-52|70.2|238/239|c.94.1.1| HM:SCP:REP 1->258|2a5sA1|7.5e-66|38.7|253/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3068 OP:NHOMOORG 701 OP:PATTERN 11---1----------1-2221112--11-1111----76993-1112----1----1------1--- ----22-------112211-17--2A111111766635781--13111122-545211--111-63443216444544211-1--------------------------111111111111111-----1--4---111111111---24--12211-------11-224-------------3441111--2623333364434434422325633432255444444439422222222222222222221333687774346666773645822233334444365767868877784443344444443366988666423458443555523234332333-221122-3155-5121-111111128---111-1321222944111111116764637767I-116115173A21OEEEEDBFDEDEC5---12542342221111111132211-21------------1111111111111--1-2-----49779KJJKKK67887EEGK888868JDL3654--9773243234A8BA--3----852222222---111116-675843977534-34-4---2---1--4-533433233211-1-1----22----675-2-----4-1111--11111121-11-2-2-1-1------88FF5987776775777-7787777677777677668GHECB5438868888888888888D766767731989999998999--3-111117666--25622233422222222143333-23651-BA8B9FDE668652A9B----------34465555545533--1-1-----------17--------------1-3-------------------------121-113111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 260 STR:RPRED 100.0 SQ:SECSTR TEEEEcccTTTcEEEEccccccccTcEEEEEEccccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEccccccccGGGcccEEEETTcHHHHHHHTTHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEEEEEcccEEcGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGcEEE DISOP:02AL 260-261| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHccccEEEccEEEEEEccccccccHHHHcccEEEEEcccHHHHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccccEEEccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccc //