[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67942.1
DDBJ      :             flagellar hook protein FlgE
Swiss-Prot:FLGE_SALTY   RecName: Full=Flagellar hook protein flgE;

Homologs  Archaea  0/68 : Bacteria  487/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.152.1
:403 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   75->364 1wlgA PDBj e-142 98.6 %
:RPS:PDB   305->398 3e66A PDBj 3e-16 10.6 %
:RPS:SCOP  75->364 1wlgA  b.152.1.1 * 6e-79 86.9 %
:HMM:SCOP  72->364 1wlgA_ b.152.1.1 * 5.1e-86 41.0 %
:RPS:PFM   173->211 PF07559 * FlaE 4e-05 56.4 %
:RPS:PFM   364->402 PF06429 * DUF1078 2e-05 53.8 %
:HMM:PFM   170->284 PF07559 * FlaE 1.6e-25 37.7 114/130  
:HMM:PFM   364->402 PF06429 * DUF1078 2e-17 59.0 39/39  
:HMM:PFM   4->33 PF00460 * Flg_bb_rod 1.2e-14 60.0 30/31  
:HMM:PFM   270->321 PF06940 * DUF1287 0.00031 23.1 52/164  
:BLT:SWISS 1->403 FLGE_SALTY 0.0 99.0 %
:PROS 9->29|PS00588|FLAGELLA_BB_ROD
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67942.1 GT:GENE ACF67942.1 GT:PRODUCT flagellar hook protein FlgE GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1264154..1265365 GB:FROM 1264154 GB:TO 1265365 GB:DIRECTION + GB:PRODUCT flagellar hook protein FlgE GB:NOTE identified by match to protein family HMM PF00460; match to protein family HMM PF06429; match to protein family HMM PF07559; match to protein family HMM TIGR03506 GB:PROTEIN_ID ACF67942.1 GB:DB_XREF GI:194407723 LENGTH 403 SQ:AASEQ MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPAAPSTTLVFNANGTLQSGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR GT:EXON 1|1-403:0| SW:ID FLGE_SALTY SW:DE RecName: Full=Flagellar hook protein flgE; SW:GN Name=flgE; Synonyms=fla FV, flaK; OrderedLocusNames=STM1177; SW:KW 3D-structure; Bacterial flagellum; Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->403|FLGE_SALTY|0.0|99.0|403/403| GO:SWS:NREP 1 GO:SWS GO:0009288|"GO:bacterial-type flagellum"|Bacterial flagellum| PROS 9->29|PS00588|FLAGELLA_BB_ROD|PDOC00508| SEG 56->74|gitqdftdgtttntgrgld| SEG 214->229|dssdpaatapaapstt| SEG 241->258|ggtvnittgtingataat| BL:PDB:NREP 1 BL:PDB:REP 75->364|1wlgA|e-142|98.6|290/293| RP:PDB:NREP 1 RP:PDB:REP 305->398|3e66A|3e-16|10.6|94/255| RP:PFM:NREP 2 RP:PFM:REP 173->211|PF07559|4e-05|56.4|39/129|FlaE| RP:PFM:REP 364->402|PF06429|2e-05|53.8|39/39|DUF1078| HM:PFM:NREP 4 HM:PFM:REP 170->284|PF07559|1.6e-25|37.7|114/130|FlaE| HM:PFM:REP 364->402|PF06429|2e-17|59.0|39/39|DUF1078| HM:PFM:REP 4->33|PF00460|1.2e-14|60.0|30/31|Flg_bb_rod| HM:PFM:REP 270->321|PF06940|0.00031|23.1|52/164|DUF1287| GO:PFM:NREP 2 GO:PFM GO:0030694|"GO:bacterial-type flagellum basal body, rod"|PF07559|IPR011491| GO:PFM GO:0019861|"GO:flagellum"|PF06429|IPR010930| RP:SCP:NREP 1 RP:SCP:REP 75->364|1wlgA|6e-79|86.9|290/293|b.152.1.1| HM:SCP:REP 72->364|1wlgA_|5.1e-86|41.0|293/0|b.152.1.1|1/1|Flagellar hook protein flgE| OP:NHOMO 1058 OP:NHOMOORG 490 OP:PATTERN -------------------------------------------------------------------- 2221------------------------------------1---1---1--1-1--------1-1------------------22222--------------------2------------------------------------2---------------------------------------------112111111111111111111122111211112211111111------------------------------------------------------------------------------------------22212111111131311111---212--11221222222231333321--22222222----224242223622522222222222-4444424422222223322333223-2222224444222--------1112-344--------------------------------222221222333522222222322224243222222--422222222--242222222242-------122-22221-22233353343-2112222222-2--2-3333-3333333322222223332---24-222222222422262422242244442---222221-22242222222222222222-2422422122224222222---2222222222222222222222211222122233333333332---------2222--422-------------------------2222222222422222333---------2222422222442222222222224------232222223333333322--------------------------2-22222122-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 80.4 SQ:SECSTR ##########################################################################cccccccEEEEEcTTccEEEEcccEEEEcTTccEEcTTccEEEEEEccTTTTcccTTcccEEccccccccccccccEEEEEEEEETTccccccccccTTcTTcccEEEEEEEEcTTccEEEEEEEEEEEETTEEEEEEEETTcTTccccccccEEEEEcTTccEEEccEEEEEccccTTccccEEEEEcTTcEEEcccccEEEEEEEcccccccEEEEEEcTTcEEEEEEcTTTGGGGGccccEEEEEcTTccEEEEEEcTTccEEEEEEcEEEEEEcGTTTcccHHHHHHHHHHHHHHHHHHHccGGGcccEEEEccGGGHHH##### PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccEEEEEEEEEcccccEEEccccEEEEEEcccEEEEEcccccEEEEEEccEEEcccccEEcccccEEEEccccccccccccccccccEEEcccccccccccEEEEEEEEccccccccccccccccccccEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEEEccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEEccccEEEEEEccccEEEEEEEEEEEEccHHHcEEccccEEEEccccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //