[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67947.1
DDBJ      :             protein YfcJ
Swiss-Prot:Y2374_SALCH  RecName: Full=UPF0226 membrane protein SCH_2374;

Homologs  Archaea  10/68 : Bacteria  151/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:392 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  18->391 1pw4A  f.38.1.1 * 2e-07 14.1 %
:HMM:SCOP  1->391 1pv7A_ f.38.1.2 * 1.2e-53 27.2 %
:RPS:PFM   249->387 PF07690 * MFS_1 2e-11 33.1 %
:HMM:PFM   20->243 PF07690 * MFS_1 6.7e-19 24.5 216/353  
:HMM:PFM   223->389 PF07690 * MFS_1 2.4e-19 30.3 165/353  
:BLT:SWISS 1->392 Y2374_SALCH 0.0 98.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67947.1 GT:GENE ACF67947.1 GT:PRODUCT protein YfcJ GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2529363..2530541) GB:FROM 2529363 GB:TO 2530541 GB:DIRECTION - GB:PRODUCT protein YfcJ GB:NOTE identified by match to protein family HMM PF07690 GB:PROTEIN_ID ACF67947.1 GB:DB_XREF GI:194407728 LENGTH 392 SQ:AASEQ MTAVSQKTTTPSANFSLFRIAFAVFLTYMTVGLPLPVIPLFVHHELGYSNTMVGIAVGIQFFATVLTRGYAGRLADQYGAKRSALQGMFACGLAGAAWLLAALLPVSAPIKFALLIVGRLILGFGESQLLTGTLTWGLGLVGPTRSGKVMSWNGMAIYGALAAGAPLGLLIHSHFGFAALAGTTMVLPLLAWAFNGTVRKVPAYTGERPSLWSVVGLIWKPGLGLALQGVGFAVIGTFISLYFVSNGWTMAGFTLTAFGGAFVLMRILFGWMPDRFGGVKVAVVSLLVETAGLLLLWLAPTAWIALVGAALTGAGCSLIFPALGVEVVKRVPAQVRGTALGGYAAFQDISYGVTGPLAGMLATSYGYPSVFLAGAISAVVGILVTILSFRRG GT:EXON 1|1-392:0| SW:ID Y2374_SALCH SW:DE RecName: Full=UPF0226 membrane protein SCH_2374; SW:GN OrderedLocusNames=SCH_2374; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->392|Y2374_SALCH|0.0|98.5|392/392| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 10 TM:REGION 17->39| TM:REGION 49->71| TM:REGION 93->115| TM:REGION 152->174| TM:REGION 176->198| TM:REGION 216->238| TM:REGION 251->273| TM:REGION 276->298| TM:REGION 307->328| TM:REGION 368->389| SEG 92->104|glagaawllaall| SEG 129->144|lltgtltwglglvgpt| SEG 159->170|galaagaplgll| RP:PFM:NREP 1 RP:PFM:REP 249->387|PF07690|2e-11|33.1|139/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 20->243|PF07690|6.7e-19|24.5|216/353|MFS_1| HM:PFM:REP 223->389|PF07690|2.4e-19|30.3|165/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 18->391|1pw4A|2e-07|14.1|370/434|f.38.1.1| HM:SCP:REP 1->391|1pv7A_|1.2e-53|27.2|378/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 271 OP:NHOMOORG 161 OP:PATTERN --------1111-11--------------------------------11---------11-------- --1-11------------------------------------------1--------------------------111---------------------------1------------------------------------------11---------------1----1-----------------------11111---------------1---1---1---------1----------------------------------------------------------------------------------------------------------------------------1---------------------------1------------------------------------1------1-1--1--------------111111111121--------------------------------------1-----111111211113122111111121---1-----------------1-----1----------------------1-------------1-------------------------------------------------------------------------------2111-2-3332333333-333333333333333333243422---312212222312322212222232-----------------------------1-----------------------1---1-11112222-2222-222---------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,199-213| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcc //