[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67977.1
DDBJ      :             repressor of phase 1 flagellin gene
Swiss-Prot:FLJA_SALTY   RecName: Full=Repressor of phase 1 flagellin gene;

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->149 PF03614 * Flag1_repress 1e-74 83.9 %
:HMM:PFM   1->149 PF03614 * Flag1_repress 1.5e-81 71.8 149/165  
:BLT:SWISS 1->156 FLJA_SALTY 2e-88 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67977.1 GT:GENE ACF67977.1 GT:PRODUCT repressor of phase 1 flagellin gene GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2887129..2887599) GB:FROM 2887129 GB:TO 2887599 GB:DIRECTION - GB:PRODUCT repressor of phase 1 flagellin gene GB:NOTE identified by match to protein family HMM PF03614 GB:PROTEIN_ID ACF67977.1 GB:DB_XREF GI:194407758 LENGTH 156 SQ:AASEQ MLARRVQFLRFNDIPVRLVSNNARIITGYIAKFNPKENLILASDKPKGNKRIEVKLESLAILEELSGNDAFNLSLVPADGFNLQQYTPSRRDYFSICNKCYKQGVGIKIYMKYGQVLTGKTTGVNACQVGVRTSNGNHMQVMFDWVSRITSSDYAE GT:EXON 1|1-156:0| SW:ID FLJA_SALTY SW:DE RecName: Full=Repressor of phase 1 flagellin gene; SW:GN Name=fljA; OrderedLocusNames=STM2770; SW:KW Complete proteome; DNA-binding; Repressor; Transcription;Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->156|FLJA_SALTY|2e-88|100.0|156/179| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| RP:PFM:NREP 1 RP:PFM:REP 1->149|PF03614|1e-74|83.9|149/165|Flag1_repress| HM:PFM:NREP 1 HM:PFM:REP 1->149|PF03614|1.5e-81|71.8|149/165|Flag1_repress| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF03614|IPR003223| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03614|IPR003223| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-1-11--11-11-----------111-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,43-43,152-157| PSIPRED cHHHHHHHHHcccccEEEEEcccEEEEEEEEcccccccEEEcccccccccEEEEEHHHHHHHHHHccccccccEEEcccccccccccccHHHHHHHHHHHHHccccEEEEEEcccEEEcccccccEEEEEEEcccccEEEEEEEHHHHHHcccccc //