[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67995.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->24 PF06363 * Picorna_P3A 0.00017 30.0 20/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67995.1 GT:GENE ACF67995.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1598215..1598343) GB:FROM 1598215 GB:TO 1598343 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF67995.1 GB:DB_XREF GI:194407776 LENGTH 42 SQ:AASEQ MDAIFISRNGPFITVFSALRFFITSSSPKKIKLKKLEASSQN GT:EXON 1|1-42:0| SEG 25->40|ssspkkiklkkleass| HM:PFM:NREP 1 HM:PFM:REP 5->24|PF06363|0.00017|30.0|20/100|Picorna_P3A| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,33-35,37-43| PSIPRED ccEEEEEccccEEEHHHHHHHHEEcccccEEEEEEEEccccc //