[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF67999.1
DDBJ      :             glycerophosphoryl diester phosphodiesterase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  366/915 : Eukaryota  24/199 : Viruses  1/175   --->[See Alignment]
c.1.18
:356 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->352 1ydyA PDBj 0.0 92.6 %
:RPS:PDB   29->349 3ch0A PDBj 6e-35 24.0 %
:RPS:SCOP  27->352 1t8qA  c.1.18.3 * e-106 89.9 %
:HMM:SCOP  26->353 1t8qA_ c.1.18.3 * 6.7e-92 35.7 %
:RPS:PFM   33->345 PF03009 * GDPD 2e-22 39.9 %
:HMM:PFM   33->347 PF03009 * GDPD 4e-77 35.7 255/255  
:BLT:SWISS 1->354 GLPQ_ECOLI 0.0 89.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67999.1 GT:GENE ACF67999.1 GT:PRODUCT glycerophosphoryl diester phosphodiesterase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2435092..2436162) GB:FROM 2435092 GB:TO 2436162 GB:DIRECTION - GB:PRODUCT glycerophosphoryl diester phosphodiesterase GB:NOTE identified by match to protein family HMM PF03009 GB:PROTEIN_ID ACF67999.1 GB:DB_XREF GI:194407780 LENGTH 356 SQ:AASEQ MKTTLKNLSVALMLAGMTIGSGAVAAEKVVIAHRGASGYLPEHTLPAKAMAYAQGADYLEQDLVMTKDDHLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRIHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAAKTLEVLKKYGYTGKQDNVYLQCFDVAELKRIKNELEPKMGMDLNLVQLIAYTDWNETQQKQPDGRWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLVAEGSTKGNIKLTGMVQDAHQNKMVVHPYTVRADQLPDYATDVNQLYDILYNKAGVDGLFTDFPDKAVMFLQKND GT:EXON 1|1-356:0| BL:SWS:NREP 1 BL:SWS:REP 1->354|GLPQ_ECOLI|0.0|89.8|354/358| BL:PDB:NREP 1 BL:PDB:REP 27->352|1ydyA|0.0|92.6|326/328| RP:PDB:NREP 1 RP:PDB:REP 29->349|3ch0A|6e-35|24.0|254/265| RP:PFM:NREP 1 RP:PFM:REP 33->345|PF03009|2e-22|39.9|238/241|GDPD| HM:PFM:NREP 1 HM:PFM:REP 33->347|PF03009|4e-77|35.7|255/255|GDPD| GO:PFM:NREP 2 GO:PFM GO:0006071|"GO:glycerol metabolic process"|PF03009|IPR004129| GO:PFM GO:0008889|"GO:glycerophosphodiester phosphodiesterase activity"|PF03009|IPR004129| RP:SCP:NREP 1 RP:SCP:REP 27->352|1t8qA|e-106|89.9|326/328|c.1.18.3| HM:SCP:REP 26->353|1t8qA_|6.7e-92|35.7|328/0|c.1.18.3|1/1|PLC-like phosphodiesterases| OP:NHOMO 476 OP:NHOMOORG 393 OP:PATTERN ---------------1-1-------------------------------------------------- -------------1-1111-111111111111-1111----11--1-1-111112-1----1--2132331---------1-2------------------1-----2-------------------------------------1121-11---------------2221------------1-1-----114222222221222221-15523221111111-11111-1111111111111111142221-----------11------1111------------------------------------------------1---2221111111-----11----1-2-1--------1---111--2-1--2111--------------------------------1--1------------1-------211----------11111111-111--1-------------------------------1-111-----111111-111111--1111111--1111--1111-111211-1----------------------1--1-1----1-111-----------------1--------------------1-1----11-1---11-1--------------------------------11-11--1111111111-111111111111111111111111111111111111111111111111111--111111121111---------------1--1-1111-1121-111111111----1-222211111---11111111111111-1--111111111111111111111-----------------1-111-1--------------------------------------- --11---------11----------------------------------------------------------------------------------------------2-------------------------------------------------1-412--2---------41------11331-241-1121- -------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 331 STR:RPRED 93.0 SQ:SECSTR #######################ccTccEEEETTTTTTTccTTcHHHHHHHHHHTccEEEEEEEEcTTccEEEcccccccTTTcETTHcEEccTTTGGGccGGGcHHHHTTccccccEEEETTEEEEccTTccTTcTTccccccccccHHHHHHHHHHHccccEEEEEEcccGGGTTTcccHHHHHHHHHHHHHHTTcGGGEEEEEccHHHHHHHHGGTTcccGGGccHHHHHHHHHHHHHTTHcTTcEEEEEEcccccHHHHHTTccccccEEEEcGGGTccTTccTTcccccHHHHHHHHHTTEEcccccccHHHHHHcccHHHHHHHHHHHHTccEEEEccGGGGTHHHTc## DISOP:02AL 1-3,355-357| PSIPRED cccHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccHHHHHHHHHccccEEEEEEEEccccEEEEccccccHHHcccccccccccccccccccHHccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHcHHHHccccHHHHHcccccccHHHHccccccccccHHHHHcHHHHHHHHHccEEEcccHHHcccccccccccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHcc //