[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68029.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->69 PF00382 * TFIIB 0.00039 25.0 44/71  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68029.1 GT:GENE ACF68029.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2559540..2559776) GB:FROM 2559540 GB:TO 2559776 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68029.1 GB:DB_XREF GI:194407810 LENGTH 78 SQ:AASEQ MKSINFKQGCILSELGESRLLRAALASEFLAEVLSVPTVNGARTVSAEGAAALVACIAEQLDGVVKETSTIKGEMRDE GT:EXON 1|1-78:0| HM:PFM:NREP 1 HM:PFM:REP 26->69|PF00382|0.00039|25.0|44/71|TFIIB| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,73-79| PSIPRED cccccHHHccHHHHHcHHHHHHHHHHHHHHHHHHcccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccc //