[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68033.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YAEQ_SALTY   RecName: Full=Uncharacterized protein yaeQ;

Homologs  Archaea  0/68 : Bacteria  239/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->180 3c0uB PDBj 7e-88 88.6 %
:RPS:PDB   2->180 3c0uB PDBj 5e-50 87.4 %
:RPS:SCOP  5->181 2g3wA1  c.52.1.33 * 1e-62 37.3 %
:RPS:PFM   1->172 PF07152 * YaeQ 2e-53 61.6 %
:HMM:PFM   1->175 PF07152 * YaeQ 3.4e-74 51.7 174/175  
:BLT:SWISS 1->181 YAEQ_SALTY e-104 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68033.1 GT:GENE ACF68033.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 288425..288970 GB:FROM 288425 GB:TO 288970 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF07152 GB:PROTEIN_ID ACF68033.1 GB:DB_XREF GI:194407814 LENGTH 181 SQ:AASEQ MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLLAWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVALFAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWLSDARNNLEIQLTAWQQPS GT:EXON 1|1-181:0| SW:ID YAEQ_SALTY SW:DE RecName: Full=Uncharacterized protein yaeQ; SW:GN Name=yaeQ; OrderedLocusNames=STM0239; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->181|YAEQ_SALTY|e-104|100.0|181/181| BL:PDB:NREP 1 BL:PDB:REP 2->180|3c0uB|7e-88|88.6|175/177| RP:PDB:NREP 1 RP:PDB:REP 2->180|3c0uB|5e-50|87.4|175/177| RP:PFM:NREP 1 RP:PFM:REP 1->172|PF07152|2e-53|61.6|172/176|YaeQ| HM:PFM:NREP 1 HM:PFM:REP 1->175|PF07152|3.4e-74|51.7|174/175|YaeQ| RP:SCP:NREP 1 RP:SCP:REP 5->181|2g3wA1|1e-62|37.3|177/179|c.52.1.33| OP:NHOMO 242 OP:NHOMOORG 241 OP:PATTERN -------------------------------------------------------------------- --------------1------1---1------11111-----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------111-111111111121111111111111111111111111111111111111111111----------1111-1-1----------111111111-----1-----------------------------111111111111111111111111111111------1------11111111111111111-111111111111111111111111---1111111111111111111111111-111111111111--------------11-1---------------11111-1---1111111111111111111----------1111-----111111111111111--------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 99.4 SQ:SECSTR cccccEEEEEEEEEEETTTTEEEEEEEEEEEcTTccHHHHHHHHHHHHHTccTTcEEcccccccccccEEEEcTTccEEEEEEEccccHHHHHHHHHHEEEEEEEEccHHHHHHHHHTTHHHHTTcTTEEEEEccHHHHHHHHTTcccEEEEEEEEETTEEEEEccccEEEEEcEEEEcc# DISOP:02AL 1-2,181-182| PSIPRED ccccccEEEEEEEEEEccccccccccEEEEEcccccHHHHHHHHHHHHHHccccccEEccccccccHHHEEccccccEEEEEEcccccHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHccccEEEEEEEccEEEEEccccEEEEEEEEEEccc //