[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68037.1
DDBJ      :             metalloprotease, opacity-associated protein A family
Swiss-Prot:YEBA_SHIFL   RecName: Full=Uncharacterized metalloprotease yebA;         EC=3.4.24.-;

Homologs  Archaea  0/68 : Bacteria  705/915 : Eukaryota  6/199 : Viruses  13/175   --->[See Alignment]
b.84.3d.7.1
:439 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   98->412 2gu1A PDBj 5e-67 41.6 %
:RPS:PDB   97->139 1e01A PDBj 9e-07 37.5 %
:RPS:PDB   293->408 2b44A PDBj 1e-28 40.0 %
:RPS:SCOP  97->139 1e0gA  d.7.1.1 * 4e-07 37.5 %
:RPS:SCOP  192->408 1qwyA  b.84.3.2 * 8e-32 23.3 %
:HMM:SCOP  94->144 1e0gA_ d.7.1.1 * 0.00058 35.4 %
:HMM:SCOP  159->407 1qwyA_ b.84.3.2 * 5.8e-66 40.7 %
:RPS:PFM   95->170 PF04225 * OapA 2e-13 50.7 %
:RPS:PFM   313->397 PF01551 * Peptidase_M23 4e-22 54.1 %
:HMM:PFM   312->406 PF01551 * Peptidase_M23 2.4e-36 52.6 95/96  
:HMM:PFM   96->170 PF04225 * OapA 7e-11 33.8 74/85  
:HMM:PFM   11->39 PF08525 * OapA_N 1.3e-09 28.6 28/30  
:BLT:SWISS 1->439 YEBA_SHIFL 0.0 92.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68037.1 GT:GENE ACF68037.1 GT:PRODUCT metalloprotease, opacity-associated protein A family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2034101..2035420) GB:FROM 2034101 GB:TO 2035420 GB:DIRECTION - GB:PRODUCT metalloprotease, opacity-associated protein A family GB:NOTE identified by match to protein family HMM PF01476; match to protein family HMM PF01551; match to protein family HMM PF04225; match to protein family HMM PF08525 GB:PROTEIN_ID ACF68037.1 GB:DB_XREF GI:194407818 LENGTH 439 SQ:AASEQ MQQIARSVALAFNNLPRPHRVMLGSLTVLTLAVAVWRPYVYHPESAPIVKTIELEKSEIRSLLPEASEPIDQAAQEDEAIPQDELDDKTAGEVGVHEYVVSTGDTLSSILNQYGIDMSDISRLAASDKELRNLKIGQQLSWTLTADGDLQRLTWEVSRRETRTYDRTANGFKMSSEMQQGDWVNSLLKGTVGGSFVASAKEAGLTSSEISAVIKAMQWQMDFRKLKKGDEFSVLMSREMLDGKREQSQLLGVRMRSDGKDYYAIRAADGKFYDRNGVGLAKGFLRFPTAKQFRISSNFNPRRLNPVTGRVAPHRGVDFAMPQGTPVLSVGDGEVVVAKRSGAAGYYIAIRHGRTYTTRYMHLRKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEVWINQQAVNPLTAKLPRTEGLTGSDRREYLAQVKEVLPQLRFD GT:EXON 1|1-439:0| SW:ID YEBA_SHIFL SW:DE RecName: Full=Uncharacterized metalloprotease yebA; EC=3.4.24.-; SW:GN Name=yebA; OrderedLocusNames=SF1866, S1932; SW:KW Cell membrane; Cell wall biogenesis/degradation; Complete proteome;Hydrolase; Membrane; Metal-binding; Metalloprotease; Protease;Transmembrane; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->439|YEBA_SHIFL|0.0|92.5|439/440| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| BL:PDB:NREP 1 BL:PDB:REP 98->412|2gu1A|5e-67|41.6|315/324| RP:PDB:NREP 2 RP:PDB:REP 97->139|1e01A|9e-07|37.5|40/48| RP:PDB:REP 293->408|2b44A|1e-28|40.0|115/129| RP:PFM:NREP 2 RP:PFM:REP 95->170|PF04225|2e-13|50.7|75/84|OapA| RP:PFM:REP 313->397|PF01551|4e-22|54.1|85/96|Peptidase_M23| HM:PFM:NREP 3 HM:PFM:REP 312->406|PF01551|2.4e-36|52.6|95/96|Peptidase_M23| HM:PFM:REP 96->170|PF04225|7e-11|33.8|74/85|OapA| HM:PFM:REP 11->39|PF08525|1.3e-09|28.6|28/30|OapA_N| RP:SCP:NREP 2 RP:SCP:REP 97->139|1e0gA|4e-07|37.5|40/48|d.7.1.1| RP:SCP:REP 192->408|1qwyA|8e-32|23.3|215/234|b.84.3.2| HM:SCP:REP 94->144|1e0gA_|0.00058|35.4|48/48|d.7.1.1|1/1|LysM domain| HM:SCP:REP 159->407|1qwyA_|5.8e-66|40.7|248/270|b.84.3.2|1/1|Duplicated hybrid motif| OP:NHOMO 2126 OP:NHOMOORG 724 OP:PATTERN -------------------------------------------------------------------- 112-131322211111111-1411111111112122679A1--1-2112351543122--323-222775-------------2-511654535112--2223331113----------------1213143313234433---42G434453433312233223576764-3-----3----42232222-2-44444343353544332111144412141452-----732224343243332232--212----------------------12-111-----------------------------------------344--22222221214-11-343214-1721647644444434565431-32-444322222213333333333333333333334-334434343451433233333333325333111111111-------------43411----------22222222212211-1125534334445422224223331123333333212122222111234443232232221223222222222122323324324344535545252132423556584211223333332333333333333221--552424324325555555564555555655--1423311----35332333323333433-343333333433333333243423223222222222222222223323333314333333333331234323232222-35131111111111-12212222221---4555554344544446444---------2445576676877555455655444353521338898994444445455--------------------------1111111111--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------6--1--1--1---- -1--------------------------------------------------------------------------------1---------------------11--11--11--------1---1-------111-------------------------------------- STR:NPRED 343 STR:RPRED 78.1 SQ:SECSTR ################################################################################################EEEEcTTccHHHHHHHHTccHHHHHHHHHTccccccccTTEEEEEEEcHHHHHHHHHHHHTTTccHHHHcccTTccGGGcTTcTTcccTTTTcccTHHHHHHHHHTTcccccHHHHHHHHHHHHHTTccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHTTcccccccTHHHHHHHHHHHHcccccccHHHHTccEEEccEEcTTccETEccEEEEccTTcEEEccccEEEEEEEEcccccEEEEEEETccEEEEEEEEccccccTTcEEcTTcEEEEccccccccccEEEEEEEEcccEEccHHcccccHHHHcccTTcEEEEcTTEEEEcTTcc DISOP:02AL 1-2,48-91,180-180,239-242,412-425,439-440| PSIPRED cHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEcccccccccccccccccccccccccccccccccccHHcccccccEEEEEEEccccHHHHHHHccccHHHHHHHHHccccHHHcccccEEEEEEcccccEEEEEEEcccccEEEEEEccccEEEEEEccccccEEEEEEEEEcccHHHHHHHccccHHHHHHHHHHHcccccHHHcccccEEEEEEHHEEccccccccEEEEEEEEccccEEEEEEcccccEEcccccccccccEEcccccccEEEccccccccccccccEEEEccEEEccccccEEEEccccEEEEEEEccccEEEEEEEccccEEEEEEEccccccccccEEccccEEEEEEccccccccEEEEEEEEccEEEccHHHcccccccccHHHHHHHHHHHHHHHHHHccc //